(data stored in ACNUC7421 zone)

EMBL: CP002343.PE487

CP002343.PE487       Location/Qualifiers
FT   CDS             542506..543675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0503"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; KEGG: ace:Acel_0975 cobyrinic acid
FT                   a,c-diamide synthase; SPTR: Probable chromosome
FT                   partitioning ATPase; PFAM: CobQ/CobB/MinD/ParA nucleotide
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47049"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T0"
FT                   /protein_id="ADU47049.1"
FT                   /translation="MTILWDLDPRAPQTYGFALGPDALQMHAAGQVGKALQEGKHALVV
FT                   IGPDIALDAACSLAELERVDRPELGVILLRHRVDVTTLAQALRSGVREVVQAGDQTSLS
FT                   DAIKRSLELTAQLSGHAHGPSAGAGKVITIFSAKGGVGKTTLATNLAAYLASTGAETLL
FT                   IDLDLMFGDVAISLQVVPAHDIGHLISMRGHLDEQGVHSVVSRHEDSGLAVIAAPSDPE
FT                   VADRVPAAVVEELLRVARGMFAYVIVDTPPNLTEHVLTACDLSDLTMLVATLDIPAVKN
FT                   LRVAMNALDTLGASKDGRVIVLNRSDAKVGLKADDVEVALQHEIRGQVPTSQSVPSSVN
FT                   RGVALVLDEPRSPVAVAIREIADREIRSRFGEQVENGSRRGFALLRSRK"
     MTILWDLDPR APQTYGFALG PDALQMHAAG QVGKALQEGK HALVVIGPDI ALDAACSLAE        60
     LERVDRPELG VILLRHRVDV TTLAQALRSG VREVVQAGDQ TSLSDAIKRS LELTAQLSGH       120
     AHGPSAGAGK VITIFSAKGG VGKTTLATNL AAYLASTGAE TLLIDLDLMF GDVAISLQVV       180
     PAHDIGHLIS MRGHLDEQGV HSVVSRHEDS GLAVIAAPSD PEVADRVPAA VVEELLRVAR       240
     GMFAYVIVDT PPNLTEHVLT ACDLSDLTML VATLDIPAVK NLRVAMNALD TLGASKDGRV       300
     IVLNRSDAKV GLKADDVEVA LQHEIRGQVP TSQSVPSSVN RGVALVLDEP RSPVAVAIRE       360
     IADREIRSRF GEQVENGSRR GFALLRSRK                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page