(data stored in ACNUC7421 zone)

EMBL: CP002343.PE488

CP002343.PE488       Location/Qualifiers
FT   CDS             543672..545060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0504"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG4962 Flp pilus assembly protein ATPase
FT                   CpaF; InterPro IPR001482: IPR017975; KEGG: tcu:Tcur_1852
FT                   type II secretion system protein E; PFAM: type II secretion
FT                   system protein E; SPTR: Flp pilus assembly protein TadA;
FT                   PFAM: Type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47050"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T1"
FT                   /protein_id="ADU47050.1"
FT                   /translation="MSSLADRLEAARRAQVFTVQDQGPAFESERAQRRARRGVDPFAGV
FT                   KDRVHQALVDSLGPRLYDPHLSEAELASQVRVTLQDVIDSEQTPLSLADRTRIAQDVSD
FT                   DILGHGPLEPFLRDQDVTEIMVNGPDDIFIEREGKIFPVDARFSDDAHLRRTIDKIVSR
FT                   VGRRVDESSPMVDARLPDGSRVNAVLPPIALDGSILTIRKFAADPFTDRDLISFGTMSP
FT                   PVRDFLEACVRGRRNIVISGGTGSGKTTTLNVLSSFLPDDERIITIEDAAELQLHQDHV
FT                   LRLESRPPNIEGRGAIAIRELVRNSLRMRPDRIIVGEVRDGAALDMLQAMNTGHDGSLT
FT                   TVHANSPRDSLSRLETMVLMAGVELPVRAIREQVASAIDLIVQQSRLKDGSRRIVAITE
FT                   VVGMESDIVTLQDIYTFDYSAGRDESGRYRGQLVPTGIRPKFTTDLADVGVELPNHLFA
FT                   RFGL"
     MSSLADRLEA ARRAQVFTVQ DQGPAFESER AQRRARRGVD PFAGVKDRVH QALVDSLGPR        60
     LYDPHLSEAE LASQVRVTLQ DVIDSEQTPL SLADRTRIAQ DVSDDILGHG PLEPFLRDQD       120
     VTEIMVNGPD DIFIEREGKI FPVDARFSDD AHLRRTIDKI VSRVGRRVDE SSPMVDARLP       180
     DGSRVNAVLP PIALDGSILT IRKFAADPFT DRDLISFGTM SPPVRDFLEA CVRGRRNIVI       240
     SGGTGSGKTT TLNVLSSFLP DDERIITIED AAELQLHQDH VLRLESRPPN IEGRGAIAIR       300
     ELVRNSLRMR PDRIIVGEVR DGAALDMLQA MNTGHDGSLT TVHANSPRDS LSRLETMVLM       360
     AGVELPVRAI REQVASAIDL IVQQSRLKDG SRRIVAITEV VGMESDIVTL QDIYTFDYSA       420
     GRDESGRYRG QLVPTGIRPK FTTDLADVGV ELPNHLFARF GL                          462
//

If you have problems or comments...

PBIL Back to PBIL home page