(data stored in ACNUC7421 zone)

EMBL: CP002343.PE49

CP002343.PE49        Location/Qualifiers
FT   CDS             complement(54559..55689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0049"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR004017: IPR012257: IPR017900: IPR017896; KEGG:
FT                   gob:Gobs_0251 protein of unknown function DUF224
FT                   cysteine-rich region domain protein; PFAM: protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46611"
FT                   /db_xref="GOA:E6SEL0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL0"
FT                   /protein_id="ADU46611.1"
FT                   /translation="MTDRGLFDKDLLAACISCGFCLPACPTYAMTQDERSSPRGRITLM
FT                   RALETGRLEEDDPTLQEQASFCLGCRACETVCPAGVQYGALLEQWRDHQWRGRHVPPAA
FT                   LALRAGMRATPLIEAAGRVRGAARPTGPARADAAAHLMLGCAERAMFPQLSRAVLRLLP
FT                   DVVDVPSGQGCCGALHAHNGDSTTAHRMAEDLGKVMPGVILTTAGGCGAHIAQVLGRDR
FT                   VRELSEFLLQYWGEHPDRLPPLGRVTVDGRPVRAALQDSCHLRNGLHVTAEPRELIARV
FT                   ADYVELPSAGTCCGAAGTYSILRPEDSQRVLDIHLDEIEAADLDYLIVVNMPCQRQMIN
FT                   GLKRRRSKVRVLHLAELLAAALDVGERERAPSQPPT"
     MTDRGLFDKD LLAACISCGF CLPACPTYAM TQDERSSPRG RITLMRALET GRLEEDDPTL        60
     QEQASFCLGC RACETVCPAG VQYGALLEQW RDHQWRGRHV PPAALALRAG MRATPLIEAA       120
     GRVRGAARPT GPARADAAAH LMLGCAERAM FPQLSRAVLR LLPDVVDVPS GQGCCGALHA       180
     HNGDSTTAHR MAEDLGKVMP GVILTTAGGC GAHIAQVLGR DRVRELSEFL LQYWGEHPDR       240
     LPPLGRVTVD GRPVRAALQD SCHLRNGLHV TAEPRELIAR VADYVELPSA GTCCGAAGTY       300
     SILRPEDSQR VLDIHLDEIE AADLDYLIVV NMPCQRQMIN GLKRRRSKVR VLHLAELLAA       360
     ALDVGERERA PSQPPT                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page