(data stored in SCRATCH zone)

EMBL: CP002343.PE490

CP002343.PE490       Location/Qualifiers
FT   CDS             547017..547937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0506"
FT                   /product="Type II secretion system F domain"
FT                   /note="COGs: COG2064 Flp pilus assembly protein TadC;
FT                   InterPro IPR018076; KEGG: tcu:Tcur_1850 type II secretion
FT                   system protein; PFAM: Type II secretion system F domain;
FT                   SPTR: Probable secretion system protein TadC; PFAM:
FT                   Bacterial type II secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47052"
FT                   /db_xref="GOA:E6S8T3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T3"
FT                   /protein_id="ADU47052.1"
FT                   /translation="MASVYIGVGLIAVAVFGLVLALSFGSGGPTGVAKSLAMIEGVVTQ
FT                   RSAVKTELDAKDRLVEPIFNRAQRIATVLSPQGTSDRLARGLERAGNPSPWTAERVMGA
FT                   KGVALLIGLLLGVAYGGFSLRGFVFALGFGGAAFWLPNLLVYNAALRRQEQVATGLAEA
FT                   LDMLTVCVEAGQGFDAALVQVARSTDGPISGEFARVLSEVQIGKSRSEAFAGLGDRVSL
FT                   SDVKNFVSAIIQADKLGIPIASVLREQTAAMRLSRRQRAEEKAQKVTVKILFPLLLCIF
FT                   PAMFVVILGPGIIRMITTLFGGNLL"
     MASVYIGVGL IAVAVFGLVL ALSFGSGGPT GVAKSLAMIE GVVTQRSAVK TELDAKDRLV        60
     EPIFNRAQRI ATVLSPQGTS DRLARGLERA GNPSPWTAER VMGAKGVALL IGLLLGVAYG       120
     GFSLRGFVFA LGFGGAAFWL PNLLVYNAAL RRQEQVATGL AEALDMLTVC VEAGQGFDAA       180
     LVQVARSTDG PISGEFARVL SEVQIGKSRS EAFAGLGDRV SLSDVKNFVS AIIQADKLGI       240
     PIASVLREQT AAMRLSRRQR AEEKAQKVTV KILFPLLLCI FPAMFVVILG PGIIRMITTL       300
     FGGNLL                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page