(data stored in ACNUC7421 zone)

EMBL: CP002343.PE494

CP002343.PE494       Location/Qualifiers
FT   CDS             complement(551022..551567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0511"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0431 flavoprotein; InterPro IPR005025;
FT                   KEGG: bfa:Bfae_17270 predicted flavoprotein; PFAM:
FT                   NADPH-dependent FMN reductase; SPTR: Putative
FT                   uncharacterized protein; PFAM: NADPH-dependent FMN
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47056"
FT                   /db_xref="GOA:E6S980"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6S980"
FT                   /protein_id="ADU47056.1"
FT                   /translation="MKQLRIIVSSTRPGRIGPKVAEWVASQAPADEWEVKVLDPSGLPF
FT                   LDEEEHPKSGKYALPHTQQWASEIFESDAIVVVTPQYNRSFPAPIKNAIDILFAEWDSK
FT                   PIAILGYGWSGGTDAAADLAKVLTHVKADVVGTTGLHFLQDLSPEGEVDATDERRGELA
FT                   ALLETLSSRLGERESVSA"
     MKQLRIIVSS TRPGRIGPKV AEWVASQAPA DEWEVKVLDP SGLPFLDEEE HPKSGKYALP        60
     HTQQWASEIF ESDAIVVVTP QYNRSFPAPI KNAIDILFAE WDSKPIAILG YGWSGGTDAA       120
     ADLAKVLTHV KADVVGTTGL HFLQDLSPEG EVDATDERRG ELAALLETLS SRLGERESVS       180
     A                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page