(data stored in ACNUC7421 zone)

EMBL: CP002343.PE495

CP002343.PE495       Location/Qualifiers
FT   CDS             complement(551623..552087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_5325 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47057"
FT                   /db_xref="UniProtKB/TrEMBL:E6S981"
FT                   /protein_id="ADU47057.1"
FT                   /translation="MDEAVERFGSAKEGYAPPPRPDGVDDATVEALGKLSEALEVVEHA
FT                   RGLLYGFHRLVGRADATLQEAVTLLRDARYDACADVVEECVVGRNVLPGLWTFQMIEAF
FT                   DDGYWRVFREVVDEVRAATGDPERHRYEAEMKAREQRPKGAAGAPPDGAV"
     MDEAVERFGS AKEGYAPPPR PDGVDDATVE ALGKLSEALE VVEHARGLLY GFHRLVGRAD        60
     ATLQEAVTLL RDARYDACAD VVEECVVGRN VLPGLWTFQM IEAFDDGYWR VFREVVDEVR       120
     AATGDPERHR YEAEMKAREQ RPKGAAGAPP DGAV                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page