(data stored in ACNUC7421 zone)

EMBL: CP002343.PE496

CP002343.PE496       Location/Qualifiers
FT   CDS             complement(552202..553572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0513"
FT                   /product="protein of unknown function DUF21"
FT                   /note="COGs: COG1253 Hemolysins and related protein
FT                   containing CBS domains; InterPro IPR000644: IPR002550:
FT                   IPR005170; KEGG: ami:Amir_4979 protein of unknown function
FT                   DUF21; PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; SPTR:
FT                   Putative uncharacterized protein; PFAM: CBS domain; Domain
FT                   of unknown function DUF21; Transporter associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47058"
FT                   /db_xref="GOA:E6S982"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6S982"
FT                   /protein_id="ADU47058.1"
FT                   /translation="MPHQVSGYWFNIALVAVLVLLNAAFSGSEMALISLREGQLKQLEK
FT                   EGTVTARRLVRLARDPNRFLATIQIGITLAGFLASATAAVALAEPLVPFLDVLGGAAEA
FT                   AAVAGVTLILTFFTLVLGELAPKRLAMQMALPWARVVARPLDLLSTFSRPAVWTLGLAT
FT                   NTVVRLLGGRAEAASEELTPDELREIVSTHQGLGPEQREIIAGAFDIQERTLREVLVPR
FT                   HQTLFLRHSMPVAEARALLAAQGHSRAPVIRGSNRDDVIGVAHWALLLDEDDRLVGEVA
FT                   TPALVLPDTANVSAALRRFKSERQQLAVVIDEHGSVDGIVTLEDLLEEVVGEIYDETDD
FT                   DSLAIERAADGSITLPGTFPVHDLEDVGVDAGLVRHGEYTTVAGLVLHRLGRIPTAPGD
FT                   TVEIDGWTIEVTAVGHHAVTEVRLVPGDTETRDTQTRDTQTRDTDTRDTGADADRAE"
     MPHQVSGYWF NIALVAVLVL LNAAFSGSEM ALISLREGQL KQLEKEGTVT ARRLVRLARD        60
     PNRFLATIQI GITLAGFLAS ATAAVALAEP LVPFLDVLGG AAEAAAVAGV TLILTFFTLV       120
     LGELAPKRLA MQMALPWARV VARPLDLLST FSRPAVWTLG LATNTVVRLL GGRAEAASEE       180
     LTPDELREIV STHQGLGPEQ REIIAGAFDI QERTLREVLV PRHQTLFLRH SMPVAEARAL       240
     LAAQGHSRAP VIRGSNRDDV IGVAHWALLL DEDDRLVGEV ATPALVLPDT ANVSAALRRF       300
     KSERQQLAVV IDEHGSVDGI VTLEDLLEEV VGEIYDETDD DSLAIERAAD GSITLPGTFP       360
     VHDLEDVGVD AGLVRHGEYT TVAGLVLHRL GRIPTAPGDT VEIDGWTIEV TAVGHHAVTE       420
     VRLVPGDTET RDTQTRDTQT RDTDTRDTGA DADRAE                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page