(data stored in SCRATCH zone)

EMBL: CP002343.PE497

CP002343.PE497       Location/Qualifiers
FT   CDS             complement(553638..554075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0514"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="COGs: COG3187 Heat shock protein; InterPro
FT                   IPR005184; KEGG: rer:RER_23460 hypothetical protein; PFAM:
FT                   protein of unknown function DUF306 Meta and HslJ; SPTR:
FT                   Putative uncharacterized protein; PFAM: META domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47059"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:E6S983"
FT                   /protein_id="ADU47059.1"
FT                   /translation="MSTPPDGPPDRPADSPTHGPADGPADGPAAPAPRTAWVVEFIAGE
FT                   ATIDPKPQISLTEDGRVLGTTGVNRISGRYEAHNETVRITGAGMTRVAGSPEAMDQERR
FT                   FLQALEGWNAFHVSDSRLDLGAPDTGLVCVLSESPTTPPSG"
     MSTPPDGPPD RPADSPTHGP ADGPADGPAA PAPRTAWVVE FIAGEATIDP KPQISLTEDG        60
     RVLGTTGVNR ISGRYEAHNE TVRITGAGMT RVAGSPEAMD QERRFLQALE GWNAFHVSDS       120
     RLDLGAPDTG LVCVLSESPT TPPSG                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page