(data stored in ACNUC7421 zone)

EMBL: CP002343.PE5

CP002343.PE5         Location/Qualifiers
FT   CDS             6399..6932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="COGs: COG5512 Zn-ribbon-containing possibly
FT                   RNA-binding protein and truncated derivatives; InterPro
FT                   IPR007922; KEGG: kra:Krad_0005 protein of unknown function
FT                   DUF721; PFAM: protein of unknown function DUF721; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46567"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW4"
FT                   /protein_id="ADU46567.1"
FT                   /translation="MPAGDAPADDTRIADAAASALARARAAARSKGLRPGMKPRRRPRA
FT                   DDPAQVRSGAGRDGRDPALLGEQLDRLLVDRGWQLDVAVGSVMGRWPEIVGPDIATHVE
FT                   PVSFADGILTVRADSTAWATQMKLLASSVLGRVEAEIGAGAVDQLRVLGPSAPSWSRGR
FT                   HRSPDSRGPRDTYG"
     MPAGDAPADD TRIADAAASA LARARAAARS KGLRPGMKPR RRPRADDPAQ VRSGAGRDGR        60
     DPALLGEQLD RLLVDRGWQL DVAVGSVMGR WPEIVGPDIA THVEPVSFAD GILTVRADST       120
     AWATQMKLLA SSVLGRVEAE IGAGAVDQLR VLGPSAPSWS RGRHRSPDSR GPRDTYG          177
//

If you have problems or comments...

PBIL Back to PBIL home page