(data stored in ACNUC7421 zone)

EMBL: CP002343.PE50

CP002343.PE50        Location/Qualifiers
FT   CDS             complement(55686..57110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0050"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterPro IPR006094: IPR004113: IPR016166; KEGG:
FT                   sen:SACE_4261 (S)-2-hydroxy-acid oxidase, subunit D; PFAM:
FT                   FAD linked oxidase domain protein; SPTR: (S)-2-hydroxy-acid
FT                   oxidase, subunit D; PFAM: FAD binding domain; FAD linked
FT                   oxidases, C-terminal domain; TIGRFAM: glycolate oxidase,
FT                   subunit GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46612"
FT                   /db_xref="GOA:E6SEL1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL1"
FT                   /protein_id="ADU46612.1"
FT                   /translation="MSTQGTTPRLHPSGSGLPADVLVELRGIVGDQYVLSLDGDVEPFS
FT                   RDATPLFRARPDAVVLPGTTEEVSAVLTLASRRGIPVTPRGAGSNLAAATIPEHGGIVL
FT                   VLTRMNRVLEVSEGELLAVVQAGTTTVTLAEAAAAKGLLYAPDPGSRTVSTVAGNVAMC
FT                   AGGLRGLKYGVTRNYVLGLEVVLPTGEVMRTGGRLWKDVAGYDLTRLLTGSEGTLAVIT
FT                   EITVGLLPMPATAMTGLAYFDHLSDAGRAVARIIAEGTLPATLEFLDNRCVNAVEDYAQ
FT                   LGLDREAGALLLFGDDGGEEMVASSLQRMADVCTAVGARGVTLAQDIAGSEALLTARRC
FT                   SLPALARLAPITMLEDVTVPRPRLAEMVETIDAIATKHSVTCATFGHAGDGNLHPTIVF
FT                   DPDDGDARHRAEAAFDEIFHAAMALGGTITGEHGVGAAKRPWLAARLGPVQMALLQRIK
FT                   TAFDPAGILNPGKLGS"
     MSTQGTTPRL HPSGSGLPAD VLVELRGIVG DQYVLSLDGD VEPFSRDATP LFRARPDAVV        60
     LPGTTEEVSA VLTLASRRGI PVTPRGAGSN LAAATIPEHG GIVLVLTRMN RVLEVSEGEL       120
     LAVVQAGTTT VTLAEAAAAK GLLYAPDPGS RTVSTVAGNV AMCAGGLRGL KYGVTRNYVL       180
     GLEVVLPTGE VMRTGGRLWK DVAGYDLTRL LTGSEGTLAV ITEITVGLLP MPATAMTGLA       240
     YFDHLSDAGR AVARIIAEGT LPATLEFLDN RCVNAVEDYA QLGLDREAGA LLLFGDDGGE       300
     EMVASSLQRM ADVCTAVGAR GVTLAQDIAG SEALLTARRC SLPALARLAP ITMLEDVTVP       360
     RPRLAEMVET IDAIATKHSV TCATFGHAGD GNLHPTIVFD PDDGDARHRA EAAFDEIFHA       420
     AMALGGTITG EHGVGAAKRP WLAARLGPVQ MALLQRIKTA FDPAGILNPG KLGS             474
//

If you have problems or comments...

PBIL Back to PBIL home page