(data stored in ACNUC7421 zone)

EMBL: CP002343.PE500

CP002343.PE500       Location/Qualifiers
FT   CDS             558482..559366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_25360 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47062"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E6S986"
FT                   /protein_id="ADU47062.1"
FT                   /translation="MSDPKPARNPIVDQLAALADLPGVRGRADAVRGACTRLRFHEALR
FT                   RRIPEAAAESRVRGARASAALDGVDYPVDLVRELTTGARPWPDELTPDLATLKGAIAAT
FT                   AESERVATIVRTAPLQALARLHVAAASPLVGGERPELLGRPRIAGEECTEFVDLGPAPD
FT                   AAEVSRRLSQLADLIVAASAATNRVPAVVVSSVVHGEVIAIRPFVHGNGLVARALERAL
FT                   VQALGLDPTGVAVPEAGHVANGTVTYTGSSAAYGKGTAAGVGLWLGQAADALLKGVDEG
FT                   ERICDAVRAGRLS"
     MSDPKPARNP IVDQLAALAD LPGVRGRADA VRGACTRLRF HEALRRRIPE AAAESRVRGA        60
     RASAALDGVD YPVDLVRELT TGARPWPDEL TPDLATLKGA IAATAESERV ATIVRTAPLQ       120
     ALARLHVAAA SPLVGGERPE LLGRPRIAGE ECTEFVDLGP APDAAEVSRR LSQLADLIVA       180
     ASAATNRVPA VVVSSVVHGE VIAIRPFVHG NGLVARALER ALVQALGLDP TGVAVPEAGH       240
     VANGTVTYTG SSAAYGKGTA AGVGLWLGQA ADALLKGVDE GERICDAVRA GRLS             294
//

If you have problems or comments...

PBIL Back to PBIL home page