(data stored in ACNUC7421 zone)

EMBL: CP002343.PE502

CP002343.PE502       Location/Qualifiers
FT   CDS             560972..562153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0519"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG4962 Flp pilus assembly protein ATPase
FT                   CpaF; InterPro IPR001482: IPR017975; KEGG: kse:Ksed_25300
FT                   Flp pilus assembly protein, ATPase CpaF; PFAM: type II
FT                   secretion system protein E; SPTR: Flp pilus assembly
FT                   protein, ATPase CpaF; PFAM: Type II/IV secretion system
FT                   protein; TIGRFAM: helicase/secretion neighborhood ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47064"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S988"
FT                   /protein_id="ADU47064.1"
FT                   /translation="MVRVTLTPAMWQRVREGRGPDPSLVTDVAKEETGALGAQRVAASR
FT                   EAIAARVLGAGPLEEWLDDGDVTDLALNGDGKVWVDRGAGMEWTGHVVPADDARGLAVR
FT                   LAAGAGRRLDEASPWVDGQLPSGARLHAVLPPLVAGGPHITIRVPARDHLSFGRLEAGG
FT                   MFPAPWGQVLRQVVARRLAFVVSGGTGAGKTTILAALLGLVDPSDRLLVVEDVRELHVD
FT                   HPHVVRLEARPPNVEGMGEVTLTTLVRQSLRMRPDRIVVGEVRGAEVRELLAALNTGHE
FT                   GGCGTVHANAPEDVIARFEALGALAGLGPAAVRAQLAAAVDVVVHVARLGPVRRVETIS
FT                   ALFRRGGEPVVETALSRGGTDGASRVGPAWPALAHRLGIDPGCVAGTTPGAGA"
     MVRVTLTPAM WQRVREGRGP DPSLVTDVAK EETGALGAQR VAASREAIAA RVLGAGPLEE        60
     WLDDGDVTDL ALNGDGKVWV DRGAGMEWTG HVVPADDARG LAVRLAAGAG RRLDEASPWV       120
     DGQLPSGARL HAVLPPLVAG GPHITIRVPA RDHLSFGRLE AGGMFPAPWG QVLRQVVARR       180
     LAFVVSGGTG AGKTTILAAL LGLVDPSDRL LVVEDVRELH VDHPHVVRLE ARPPNVEGMG       240
     EVTLTTLVRQ SLRMRPDRIV VGEVRGAEVR ELLAALNTGH EGGCGTVHAN APEDVIARFE       300
     ALGALAGLGP AAVRAQLAAA VDVVVHVARL GPVRRVETIS ALFRRGGEPV VETALSRGGT       360
     DGASRVGPAW PALAHRLGID PGCVAGTTPG AGA                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page