(data stored in ACNUC7421 zone)

EMBL: CP002343.PE505

CP002343.PE505       Location/Qualifiers
FT   CDS             563675..563863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jde:Jden_2222 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47067"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:E6S991"
FT                   /protein_id="ADU47067.1"
FT                   /translation="MTQRMKRRMHGWLSESGMSTSEYAVGIMAACTFALVLLGVVRSDA
FT                   VRSALTGIVQSALGLAG"
     MTQRMKRRMH GWLSESGMST SEYAVGIMAA CTFALVLLGV VRSDAVRSAL TGIVQSALGL        60
     AG                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page