(data stored in ACNUC7421 zone)

EMBL: CP002343.PE508

CP002343.PE508       Location/Qualifiers
FT   CDS             complement(564781..565245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0525"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="COGs: COG1959 transcriptional regulator protein;
FT                   InterPro IPR000944; KEGG: cai:Caci_3768 transcriptional
FT                   regulator, BadM/Rrf2 family; PFAM: protein of unknown
FT                   function UPF0074; SPTR: Putative uncharacterized protein;
FT                   TIGRFAM: transcriptional regulator, Rrf2 family; PFAM:
FT                   Transcriptional regulator; TIGRFAM: rrf2 family protein
FT                   (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47070"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S994"
FT                   /protein_id="ADU47070.1"
FT                   /translation="MDISARVDYAVRAMLILAEAAASGSGPVSIEALATEQELPRKFLE
FT                   AIFADLRRAELVLSRRGALGGYALARPQREISVGDVFRAVDGPLAEVRGLRPHETSYAG
FT                   VAQHLPSLWVAVRASLREVLDGTSLEALRTGALPEPLQQLLTAPDAWRNR"
     MDISARVDYA VRAMLILAEA AASGSGPVSI EALATEQELP RKFLEAIFAD LRRAELVLSR        60
     RGALGGYALA RPQREISVGD VFRAVDGPLA EVRGLRPHET SYAGVAQHLP SLWVAVRASL       120
     REVLDGTSLE ALRTGALPEP LQQLLTAPDA WRNR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page