(data stored in ACNUC7421 zone)

EMBL: CP002343.PE509

CP002343.PE509       Location/Qualifiers
FT   CDS             complement(565440..566450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0526"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="COGs: COG1118 ABC-type sulfate/molybdate transport
FT                   systems ATPase component; InterProIPR003439: IPR014769:
FT                   IPR005116: IPR003593: IPR 017871: IPR005666; KEGG:
FT                   rha:RHA1_ro01270 ABC sulfate/thiosulfate porter,
FT                   ATP-binding component; PFAM: ABC transporter related; TOBE
FT                   domain-containing protein; SMART: AAA ATPase; SPTR:
FT                   Putative sulfate ABC transporter ATP-binding protein;
FT                   TIGRFAM: sulfate ABC transporter, ATPase subunit; PFAM: ABC
FT                   transporter; TOBE domain; TIGRFAM: sulfate ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47071"
FT                   /db_xref="GOA:E6S995"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S995"
FT                   /protein_id="ADU47071.1"
FT                   /translation="MITVTGARKEFGSFTALDDVSLDIPSGSLTALLGPSGSGKSTLLR
FT                   AIAGLESLDSGVVSIGGRDVTGEPPQRRGIGFVFQHYAAFKHLTVRDNVAFGLTIRKRP
FT                   KTETDAKVNELLTVVGLEGFAHRYPAQLSGGQRQRMALARALAVDPEVLLLDEPFGALD
FT                   AKVRTDLRTWLRRLHDEVHVTTVLVTHDQEEALDVADRIAVLNHGRIEQVGDPVTLYDR
FT                   PANDFVMSFLGSVSKLGEQLVRPHDIILERDHALALAADAQVPGSPGVIRAVVERVVRL
FT                   GFEVRVDLRADSGERFAAQITRRDADGLDLRDGEPITARAAHRSSVVDHDPALAI"
     MITVTGARKE FGSFTALDDV SLDIPSGSLT ALLGPSGSGK STLLRAIAGL ESLDSGVVSI        60
     GGRDVTGEPP QRRGIGFVFQ HYAAFKHLTV RDNVAFGLTI RKRPKTETDA KVNELLTVVG       120
     LEGFAHRYPA QLSGGQRQRM ALARALAVDP EVLLLDEPFG ALDAKVRTDL RTWLRRLHDE       180
     VHVTTVLVTH DQEEALDVAD RIAVLNHGRI EQVGDPVTLY DRPANDFVMS FLGSVSKLGE       240
     QLVRPHDIIL ERDHALALAA DAQVPGSPGV IRAVVERVVR LGFEVRVDLR ADSGERFAAQ       300
     ITRRDADGLD LRDGEPITAR AAHRSSVVDH DPALAI                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page