(data stored in ACNUC7421 zone)

EMBL: CP002343.PE511

CP002343.PE511       Location/Qualifiers
FT   CDS             complement(567250..568137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0528"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="COGs: COG0555 ABC-type sulfate transport system
FT                   permease component; InterPro IPR000515: IPR005667:
FT                   IPR011865; KEGG: rha:RHA1_ro01272 ABC sulfate/thiosulfate
FT                   porter, permease component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Sulfate/thiosulfate ABC superfamily ATP binding cassette
FT                   transporter, membrane protein; TIGRFAM: sulfate ABC
FT                   transporter, inner membrane subunit CysT; sulfate ABC
FT                   transporter, inner membrane subunit; manually curated;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component; TIGRFAM: sulfate ABC transporter,
FT                   permease protein; sulfate ABC transporter, permease protein
FT                   CysT"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47073"
FT                   /db_xref="GOA:E6S997"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S997"
FT                   /protein_id="ADU47073.1"
FT                   /translation="MEARTAQARTVRPGSPAHGPAPGRAGRSRRRLRSGLQPLGIGVVT
FT                   LWLSVIVLLPLAALTVASFEGGLGGFWDAATAPVALASLRVTVTVSAIVAAVNAVLGTL
FT                   VAWVLVRDRFAGQAVVNALIDLPFALPTIVASIVLLSLYGPGSPVGVQLNATTWGLFVA
FT                   LAFVTLPFVVRSVQPVLIEADREVEEAAASLGATNWTTFRRIVLPTLAPAVLSGTGLAF
FT                   ARAIGEYGSVVLIGGNIPRETQVASQYIQQQIEMDRPANAAAVSVVLLLIAFATLLVLR
FT                   VLSTRSQRREERAP"
     MEARTAQART VRPGSPAHGP APGRAGRSRR RLRSGLQPLG IGVVTLWLSV IVLLPLAALT        60
     VASFEGGLGG FWDAATAPVA LASLRVTVTV SAIVAAVNAV LGTLVAWVLV RDRFAGQAVV       120
     NALIDLPFAL PTIVASIVLL SLYGPGSPVG VQLNATTWGL FVALAFVTLP FVVRSVQPVL       180
     IEADREVEEA AASLGATNWT TFRRIVLPTL APAVLSGTGL AFARAIGEYG SVVLIGGNIP       240
     RETQVASQYI QQQIEMDRPA NAAAVSVVLL LIAFATLLVL RVLSTRSQRR EERAP            295
//

If you have problems or comments...

PBIL Back to PBIL home page