(data stored in ACNUC7421 zone)

EMBL: CP002343.PE512

CP002343.PE512       Location/Qualifiers
FT   CDS             complement(568275..569330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0529"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="COGs: COG1613 ABC-type sulfate transport system
FT                   periplasmic component; InterPro IPR006059: IPR005669; KEGG:
FT                   rop:ROP_09930 sulfate ABC transporter sulfate-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: Sulfate ABC transporter sulfate-binding protein;
FT                   TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding protein; TIGRFAM:
FT                   sulfate/thiosulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47074"
FT                   /db_xref="GOA:E6S998"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:E6S998"
FT                   /protein_id="ADU47074.1"
FT                   /translation="MPRPRPTAPRSRILRGLAALAVLALAGCTGAGPSDVVVQPGAARV
FT                   AAAPTTTLNLFAHAVAKPAHDAVVPAFQRTPAGTGVAFQQSYGASGDQSRKVAAGAEAD
FT                   LVQLSTEPDLTRLVDAGLIDPTWNAGEHGGVPFGSVVTLVVRTGNPKGIADWDDLLQPE
FT                   VEVVTPNPFSSGSARWNLLAPFAAESHGGADPAAGLAYVEKLVSEHVRIQPKSSREATE
FT                   AFLQGRGDVLLSYENEALFIEQNGDPVEHVTPPQTFRIDNPVAVLKGSENLPVAEAFAD
FT                   YLYTPEAQRLLARAGFRPVDEQVAAEFAKAFPRPEKLWTIADLGGWTAVDAALFEPRTG
FT                   AIATIYDAVTQ"
     MPRPRPTAPR SRILRGLAAL AVLALAGCTG AGPSDVVVQP GAARVAAAPT TTLNLFAHAV        60
     AKPAHDAVVP AFQRTPAGTG VAFQQSYGAS GDQSRKVAAG AEADLVQLST EPDLTRLVDA       120
     GLIDPTWNAG EHGGVPFGSV VTLVVRTGNP KGIADWDDLL QPEVEVVTPN PFSSGSARWN       180
     LLAPFAAESH GGADPAAGLA YVEKLVSEHV RIQPKSSREA TEAFLQGRGD VLLSYENEAL       240
     FIEQNGDPVE HVTPPQTFRI DNPVAVLKGS ENLPVAEAFA DYLYTPEAQR LLARAGFRPV       300
     DEQVAAEFAK AFPRPEKLWT IADLGGWTAV DAALFEPRTG AIATIYDAVT Q                351
//

If you have problems or comments...

PBIL Back to PBIL home page