(data stored in ACNUC7421 zone)

EMBL: CP002343.PE514

CP002343.PE514       Location/Qualifiers
FT   CDS             complement(570008..573001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0531"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="InterPro IPR010259: IPR000209: IPR003137: IPR007280;
FT                   KEGG: kfl:Kfla_2384 protease-associated PA domain protein;
FT                   PFAM: peptidase S8 and S53 subtilisin kexin sedolisin;
FT                   proteinase inhibitor I9 subtilisin propeptide;
FT                   protease-associated PA domain protein; peptidase domain
FT                   protein; SPTR: Protease-associated PA domain protein; PFAM:
FT                   PA domain; Peptidase inhibitor I9; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47076"
FT                   /db_xref="GOA:E6S9A0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034197"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A0"
FT                   /protein_id="ADU47076.1"
FT                   /translation="MKRRLLGAVTAVPVALAMAGTGAADAAVTQSVPPSTSGTYIVQMA
FT                   DLPVVAYDGKIKGLAATSPTPGTKVDPQSDAVTRYVAHLESKHNSALTRVGATSTKIYD
FT                   YAFSFNGFAAKLTAAQAQRLTKAPGVVAVNPEQTYTVDTSTTPDFLGLTAKGGLWDQLG
FT                   GTGSAGEDILIGTIDSGIWPEHLSFSDRATAGVPSASGPVVYAPFDGPADACKAGENWT
FT                   AKTCNNKLVIARHFNESWGGDKGIRKDRPWEFTSPRDYNGHGTHTASTSGGNHDVPVPG
FT                   IASALAPNGMSGIAPRARVAAYKALWSTETGDTASGRGGDLVAAIDQAVADGVDVINYS
FT                   ISGSQTNFADGAEIAFLFAARAGVFVAASAGNSGPTASTVAHPSPWITTVAAGTHNRAS
FT                   HGSVTLGNGATYEGASLAAEAVTAPFIDSTSAGLAGADPTKVALCYSSADGGNVLDPAK
FT                   VAGKIVLCDRGATARTNKSLAVKEAGGVGLVLVNTSPIGINADLHTIPSVHLESTERAP
FT                   VKAYAATSGATATINVAELDLNAPAPFTAGFSSRGPLSAGSGDLLKPDVIAPGQDILAA
FT                   YTPVTNGGYAYNAISGTSMSSPHVAGLAALLRDRHPGWSPMAIKSALMTTDYDVKDEAS
FT                   TADKAFRQGAGHVNPNAAAKAGLVYDSGWNDWLAFLCGTTSAVGAGTCDALVSRGYSTD
FT                   PSQFNGASIASGALAGSETITRRVTNVGATTATYKASITLRGFDVEVSPKKLVLAPGQT
FT                   KSFTVTITREDAPLNSYTGGHLVWTSGTTTVRSPIVVRPVALAAPGEVRAEPSGTSYGV
FT                   TFGYTGDFAATGRGLVPAAATSGTVADDPTDSTCSLSSPNAQKVEVAVPAGTTYARFAL
FT                   FDADVNPGTDLDLCVFDSTEKNVGSSGSGTSAEQVNLLNPGAGTYTVVVQGWGVAGTSP
FT                   FKLHTWVLGSAAEDNLTVTAPTSATIGQSGTVTLGFTGLTSGKWLGSVAYSGAEGMPNP
FT                   TIVRVDVP"
     MKRRLLGAVT AVPVALAMAG TGAADAAVTQ SVPPSTSGTY IVQMADLPVV AYDGKIKGLA        60
     ATSPTPGTKV DPQSDAVTRY VAHLESKHNS ALTRVGATST KIYDYAFSFN GFAAKLTAAQ       120
     AQRLTKAPGV VAVNPEQTYT VDTSTTPDFL GLTAKGGLWD QLGGTGSAGE DILIGTIDSG       180
     IWPEHLSFSD RATAGVPSAS GPVVYAPFDG PADACKAGEN WTAKTCNNKL VIARHFNESW       240
     GGDKGIRKDR PWEFTSPRDY NGHGTHTAST SGGNHDVPVP GIASALAPNG MSGIAPRARV       300
     AAYKALWSTE TGDTASGRGG DLVAAIDQAV ADGVDVINYS ISGSQTNFAD GAEIAFLFAA       360
     RAGVFVAASA GNSGPTASTV AHPSPWITTV AAGTHNRASH GSVTLGNGAT YEGASLAAEA       420
     VTAPFIDSTS AGLAGADPTK VALCYSSADG GNVLDPAKVA GKIVLCDRGA TARTNKSLAV       480
     KEAGGVGLVL VNTSPIGINA DLHTIPSVHL ESTERAPVKA YAATSGATAT INVAELDLNA       540
     PAPFTAGFSS RGPLSAGSGD LLKPDVIAPG QDILAAYTPV TNGGYAYNAI SGTSMSSPHV       600
     AGLAALLRDR HPGWSPMAIK SALMTTDYDV KDEASTADKA FRQGAGHVNP NAAAKAGLVY       660
     DSGWNDWLAF LCGTTSAVGA GTCDALVSRG YSTDPSQFNG ASIASGALAG SETITRRVTN       720
     VGATTATYKA SITLRGFDVE VSPKKLVLAP GQTKSFTVTI TREDAPLNSY TGGHLVWTSG       780
     TTTVRSPIVV RPVALAAPGE VRAEPSGTSY GVTFGYTGDF AATGRGLVPA AATSGTVADD       840
     PTDSTCSLSS PNAQKVEVAV PAGTTYARFA LFDADVNPGT DLDLCVFDST EKNVGSSGSG       900
     TSAEQVNLLN PGAGTYTVVV QGWGVAGTSP FKLHTWVLGS AAEDNLTVTA PTSATIGQSG       960
     TVTLGFTGLT SGKWLGSVAY SGAEGMPNPT IVRVDVP                                997
//

If you have problems or comments...

PBIL Back to PBIL home page