(data stored in ACNUC7421 zone)

EMBL: CP002343.PE515

CP002343.PE515       Location/Qualifiers
FT   CDS             complement(573173..575170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0532"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG1205 Distinct helicase family with a unique
FT                   C-terminal domain including a metal-binding cysteine
FT                   cluster; InterPro IPR014021: IPR001650: IPR011545:
FT                   IPR014001; KEGG: nca:Noca_0370 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; SPTR: Putative
FT                   ATP-dependent RNA helicase; PFAM: Helicase conserved
FT                   C-terminal domain; DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47077"
FT                   /db_xref="GOA:E6S9A1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A1"
FT                   /protein_id="ADU47077.1"
FT                   /translation="MNGSDALFNAPPAPSDDGDRDQRAFDPEALLHRLVGEHPERLLHV
FT                   HEVPARPARHAEWPGWVDPTLLGALLGSGIDRPWRHQVEVAEAAHRGDHVVVSTGTASG
FT                   KSLGYLLPLLTDVVTGARAPSGRGSTALYLAPTKALAADQLDRITRLALPPVRAATYDG
FT                   DTPTDERRWIRDHANVVLTNPDLVHHSLLPRHDRWAPFLRALRYVVVDECHVYKGVFGA
FT                   HLAAVLRRLRRVAARYHASPTFVFASATVADPSVHASRLLGMPLSSVTEDGSPRAPMTF
FT                   ALWEPPVRTDDQGRPKRVSTLTETGDLLAQCVEEDVQTAVFARSRAGVEVVANVARDRV
FT                   STTREARIAAYRGGYLPEERRELERALRSRRLVGIAATNALELGVDVSGLDAVVLAGWP
FT                   GTLASLWQQAGRAGRTGHRSLAILVAADDPLDTFVVHHPESIFGRAVEATVVDPDNPYV
FT                   LGPHLAAAAAELPLTEGDLELFGPQTRPLLDALVAKGILKKRPRGWFWTREDRPADHVS
FT                   LRGAGEPVRIVETRTGRVVATVDEASAHAQVHTGAVHLHQGQTWVVTELDLDDGAAFAV
FT                   RGDPGWTTHAQSVSEFTIVRELEAVEWGPLRCSFGQVTVTHQVVSFLRRLPGGEVLGEH
FT                   PLDLPPRSLATKAMWWTLLDLTLSRAGSRR"
     MNGSDALFNA PPAPSDDGDR DQRAFDPEAL LHRLVGEHPE RLLHVHEVPA RPARHAEWPG        60
     WVDPTLLGAL LGSGIDRPWR HQVEVAEAAH RGDHVVVSTG TASGKSLGYL LPLLTDVVTG       120
     ARAPSGRGST ALYLAPTKAL AADQLDRITR LALPPVRAAT YDGDTPTDER RWIRDHANVV       180
     LTNPDLVHHS LLPRHDRWAP FLRALRYVVV DECHVYKGVF GAHLAAVLRR LRRVAARYHA       240
     SPTFVFASAT VADPSVHASR LLGMPLSSVT EDGSPRAPMT FALWEPPVRT DDQGRPKRVS       300
     TLTETGDLLA QCVEEDVQTA VFARSRAGVE VVANVARDRV STTREARIAA YRGGYLPEER       360
     RELERALRSR RLVGIAATNA LELGVDVSGL DAVVLAGWPG TLASLWQQAG RAGRTGHRSL       420
     AILVAADDPL DTFVVHHPES IFGRAVEATV VDPDNPYVLG PHLAAAAAEL PLTEGDLELF       480
     GPQTRPLLDA LVAKGILKKR PRGWFWTRED RPADHVSLRG AGEPVRIVET RTGRVVATVD       540
     EASAHAQVHT GAVHLHQGQT WVVTELDLDD GAAFAVRGDP GWTTHAQSVS EFTIVRELEA       600
     VEWGPLRCSF GQVTVTHQVV SFLRRLPGGE VLGEHPLDLP PRSLATKAMW WTLLDLTLSR       660
     AGSRR                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page