(data stored in ACNUC7421 zone)

EMBL: CP002343.PE516

CP002343.PE516       Location/Qualifiers
FT   CDS             575293..575676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0533"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="COGs: COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor); InterPro IPR002645:
FT                   IPR003658; KEGG: kfl:Kfla_0571 anti-sigma-factor
FT                   antagonist; PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; SPTR: Anti-sigma factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: STAS domain;
FT                   TIGRFAM: anti-anti-sigma factor; anti-sigma F factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47078"
FT                   /db_xref="GOA:E6S9A2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A2"
FT                   /protein_id="ADU47078.1"
FT                   /translation="MDLSITRADHGDRTVVHLGGEIDVYTAPFVREKLDEQIHAGRADL
FT                   IVDLSEVTFLDSTGLGVLVGRLKFARTRGGSLKLVGTSERVLRVFAITGLDKVFDIHPD
FT                   LESALAAPDQGEAPMPPTSNARH"
     MDLSITRADH GDRTVVHLGG EIDVYTAPFV REKLDEQIHA GRADLIVDLS EVTFLDSTGL        60
     GVLVGRLKFA RTRGGSLKLV GTSERVLRVF AITGLDKVFD IHPDLESALA APDQGEAPMP       120
     PTSNARH                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page