(data stored in SCRATCH zone)

EMBL: CP002343.PE518

CP002343.PE518       Location/Qualifiers
FT   CDS             577440..578081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0535"
FT                   /product="regulatory protein TetR"
FT                   /note="InterPro IPR001647; KEGG: tpr:Tpau_2624
FT                   transcriptional regulator, TetR family; PFAM: regulatory
FT                   protein TetR; SPTR: Transcriptional regulator, TetR family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47080"
FT                   /db_xref="GOA:E6S9A4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A4"
FT                   /protein_id="ADU47080.1"
FT                   /translation="MATTAARAAPLPPTERREALIDVFLDLARRHGRVPTTSEIAGAAG
FT                   VAEGTIFRVFPSKDALQTAAVEAAFCPASARRDFVAIDRSQPMRDRLVAFAASLQRRIR
FT                   DVLDLMGALGLSQPPPLHQHAACLETGRHVPSEPSADCAALHVDLFEAVLDLVDPDAIT
FT                   VTPHQLLHRIRLLSFSGSHPGIAHGELLTPEEVVDTVLYGVCARPGPIRD"
     MATTAARAAP LPPTERREAL IDVFLDLARR HGRVPTTSEI AGAAGVAEGT IFRVFPSKDA        60
     LQTAAVEAAF CPASARRDFV AIDRSQPMRD RLVAFAASLQ RRIRDVLDLM GALGLSQPPP       120
     LHQHAACLET GRHVPSEPSA DCAALHVDLF EAVLDLVDPD AITVTPHQLL HRIRLLSFSG       180
     SHPGIAHGEL LTPEEVVDTV LYGVCARPGP IRD                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page