(data stored in ACNUC7421 zone)

EMBL: CP002343.PE519

CP002343.PE519       Location/Qualifiers
FT   CDS             578149..579879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0536"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterProIPR003439:
FT                   IPR017940: IPR001140: IPR003593: IPR 017871; KEGG:
FT                   kfl:Kfla_3612 ABC transporter related protein; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   SMART: AAA ATPase; SPTR: Putative ABC transporter; PFAM:
FT                   ABC transporter transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47081"
FT                   /db_xref="GOA:E6S9A5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A5"
FT                   /protein_id="ADU47081.1"
FT                   /translation="MLLRLLRSHLLAYRGEITLIVLLQLASTIASLYLPSLNGEIIDDG
FT                   VAKGDTDFIMSHGALMLGVSVVQIATAVAATFLAARVAMGIGRDLRAKVFDTVIDYSAQ
FT                   EVSRFGAPTLISRNTNDVTQVQTVLFMGFAILVSTPIMMFGGIIMALREDVGLSWLVAV
FT                   AVPLLGLVVATVIWRMMPWFTRMQTSLDGVNRVLREQITGIRVVRAFVREGHEEARFGR
FT                   ANADLTEAGLRVGRLMALVFPVVMFIFSMSTVAVLWFGAYRVDSGAMEVGSLTAFLAYL
FT                   VQILMAVMMATFMATMIPRASVSAGRIAEVLDTASSIVQSVQPIPIRVPRAGVEFVDVE
FT                   FHYPGAEHAVLNGITFEASSGRTTAIIGSTGAGKTTLLGLVPRLFDVRSGRVKVGDVDV
FT                   RDLELDALWARIGLVPQKPYLFTGTVASNLRYGNPDATDDELWEALRISQAADFVTQLG
FT                   GLDTAIVQGGTNVSGGQRQRLAIARAVVKRPDIYLFDDSFSALDLSTDARLRAALRPVT
FT                   RDATVVIVAQRVSTIIDADHIVVLDDGRIVGQGTHDELLQTCETYQEIALSQRAAEEVA
FT                   "
     MLLRLLRSHL LAYRGEITLI VLLQLASTIA SLYLPSLNGE IIDDGVAKGD TDFIMSHGAL        60
     MLGVSVVQIA TAVAATFLAA RVAMGIGRDL RAKVFDTVID YSAQEVSRFG APTLISRNTN       120
     DVTQVQTVLF MGFAILVSTP IMMFGGIIMA LREDVGLSWL VAVAVPLLGL VVATVIWRMM       180
     PWFTRMQTSL DGVNRVLREQ ITGIRVVRAF VREGHEEARF GRANADLTEA GLRVGRLMAL       240
     VFPVVMFIFS MSTVAVLWFG AYRVDSGAME VGSLTAFLAY LVQILMAVMM ATFMATMIPR       300
     ASVSAGRIAE VLDTASSIVQ SVQPIPIRVP RAGVEFVDVE FHYPGAEHAV LNGITFEASS       360
     GRTTAIIGST GAGKTTLLGL VPRLFDVRSG RVKVGDVDVR DLELDALWAR IGLVPQKPYL       420
     FTGTVASNLR YGNPDATDDE LWEALRISQA ADFVTQLGGL DTAIVQGGTN VSGGQRQRLA       480
     IARAVVKRPD IYLFDDSFSA LDLSTDARLR AALRPVTRDA TVVIVAQRVS TIIDADHIVV       540
     LDDGRIVGQG THDELLQTCE TYQEIALSQR AAEEVA                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page