(data stored in ACNUC7421 zone)

EMBL: CP002343.PE522

CP002343.PE522       Location/Qualifiers
FT   CDS             585353..586363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0539"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="COGs: COG0598 Mg2+ and Co2+ transporter; InterPro
FT                   IPR002523; KEGG: rxy:Rxyl_0057 magnesium and cobalt
FT                   transport protein CorA; PFAM: Mg2 transporter protein CorA
FT                   family protein; SPTR: Magnesium and cobalt transport
FT                   protein CorA; PFAM: CorA-like Mg2+ transporter protein;
FT                   TIGRFAM: magnesium Mg(2+) and cobalt Co(2+) transport
FT                   protein (corA)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47084"
FT                   /db_xref="GOA:E6S9A8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A8"
FT                   /protein_id="ADU47084.1"
FT                   /translation="MIIDCALYRDGRRQQEAALTLDTAAALHQDGSEGFAWLGTFEPAP
FT                   DELERIRDSFGLHELAVEDVQTFHLRPKMEQYDHGVELVILRTARYDDEREEVDFGEIS
FT                   VFIAPTFVITVRQGVASELHTARTNLEARPDLLAEGSPAVLWAILDQVIKSYGPVVAEL
FT                   ERDIEQVESTVFAGEAAPTERIYFLRREVTNFYRAVHPLLTVLTTIERTYREGPLAPYL
FT                   HDVHDYLRLISDEVAAQRDLLATILEANMAVISVEQTRLGIRQGQTIERLTVLATVFLP
FT                   LTFVTGFFGQNFPWLVEHLDGFGRFVVLGIGGLVLPLVVLWVLLRRDRGRLDRST"
     MIIDCALYRD GRRQQEAALT LDTAAALHQD GSEGFAWLGT FEPAPDELER IRDSFGLHEL        60
     AVEDVQTFHL RPKMEQYDHG VELVILRTAR YDDEREEVDF GEISVFIAPT FVITVRQGVA       120
     SELHTARTNL EARPDLLAEG SPAVLWAILD QVIKSYGPVV AELERDIEQV ESTVFAGEAA       180
     PTERIYFLRR EVTNFYRAVH PLLTVLTTIE RTYREGPLAP YLHDVHDYLR LISDEVAAQR       240
     DLLATILEAN MAVISVEQTR LGIRQGQTIE RLTVLATVFL PLTFVTGFFG QNFPWLVEHL       300
     DGFGRFVVLG IGGLVLPLVV LWVLLRRDRG RLDRST                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page