(data stored in SCRATCH zone)

EMBL: CP002343.PE527

CP002343.PE527       Location/Qualifiers
FT   CDS             complement(589747..591021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0544"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG0631 Serine/threonine protein phosphatase;
FT                   InterPro IPR014045: IPR001932; KEGG: kfl:Kfla_5976 protein
FT                   serine/threonine phosphatase; PFAM: Protein phosphatase
FT                   2C-like; SMART: protein phosphatase 2C domain protein;
FT                   SPTR: Protein serine/threonine phosphatase; PFAM: Protein
FT                   phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47089"
FT                   /db_xref="GOA:E6S9B3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B3"
FT                   /protein_id="ADU47089.1"
FT                   /translation="MTDASPPRLPQATQFPQATGPEPTCPSCGTPNPPDASFCEACGAG
FT                   LAPGQQGAGASPAAYGGVVSPATPQTAPTGEESPLDVGWTGPVPSTATGPAQPTGAEAQ
FT                   PCQSCGEGHYVDGYCDHCGSPPPDPRNHFAESPAPWVGGVCDIGRRHARNEDAMALTAT
FT                   EAPGSRAVLVVCDGVSMATDSHIASLAAARAARAVLDQPLPRGAGTRDAWEAAAARALT
FT                   TAVATANDAVRSAVEGEQENPPSCTIAAAVIEDGAVVTGNVGDSRVYWLPDRPELPPRQ
FT                   LGRDDSYAHEQMLAGVPRDAAENGPHAHSITRWLGTDAPDDLTPHLTTLAADDTTAGWL
FT                   LVCSDGLWNYCSAAADMRVLVHNMVTEAGPDPTPTAVAQALVDFANEQGGRDNITVALA
FT                   RLGGQGSQETTGAEAAPQEGDPIHG"
     MTDASPPRLP QATQFPQATG PEPTCPSCGT PNPPDASFCE ACGAGLAPGQ QGAGASPAAY        60
     GGVVSPATPQ TAPTGEESPL DVGWTGPVPS TATGPAQPTG AEAQPCQSCG EGHYVDGYCD       120
     HCGSPPPDPR NHFAESPAPW VGGVCDIGRR HARNEDAMAL TATEAPGSRA VLVVCDGVSM       180
     ATDSHIASLA AARAARAVLD QPLPRGAGTR DAWEAAAARA LTTAVATAND AVRSAVEGEQ       240
     ENPPSCTIAA AVIEDGAVVT GNVGDSRVYW LPDRPELPPR QLGRDDSYAH EQMLAGVPRD       300
     AAENGPHAHS ITRWLGTDAP DDLTPHLTTL AADDTTAGWL LVCSDGLWNY CSAAADMRVL       360
     VHNMVTEAGP DPTPTAVAQA LVDFANEQGG RDNITVALAR LGGQGSQETT GAEAAPQEGD       420
     PIHG                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page