(data stored in ACNUC7421 zone)

EMBL: CP002343.PE53

CP002343.PE53        Location/Qualifiers
FT   CDS             complement(59909..62113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0053"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="InterPro IPR011600: IPR018247; KEGG: amd:AMED_1757
FT                   caspase-related protein; PFAM: peptidase C14 caspase
FT                   catalytic subunit p20; SPTR: Putative uncharacterized
FT                   protein; PFAM: Caspase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46615"
FT                   /db_xref="GOA:E6SEL4"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL4"
FT                   /protein_id="ADU46615.1"
FT                   /translation="MSGTRRALIVANDTYDHASLGQLRAPAADAEALADVLGDPEVGGF
FT                   TVTVVHNEPSYEVQSRIEDAFADSRPDDLLLLHFSGHGLKSDTGELFVAARNTRPDRLG
FT                   STAVSADFIQRCMKTSRARSIVLFLDCCYGGAFGEGVTVRAAGPVNVMDSFPAERLGGG
FT                   RGRAVISASSAIEYAFEGTALAADQTVRPSVFTSAVVEGLRTGDADRDEDGLVSLDELY
FT                   DYVFDRVRAENPKQTPGRDVEMAGDLYVARSRRRRLRPAPIPEAVAAALKEANPTFRRG
FT                   AVSELRDRLLHDDPAAALGALEALRDVVRTDTKSVADDAAAALASARMTVVPVSIDLGG
FT                   GGVGSEPRTGMVEVHGPALVQELTVQADPPLEAHVEDDGRVAVELPPGVEAFAGQLTIT
FT                   SPLGSVVVPVTASPASVAGAAEQATEPGSDETVRTTPQAETLVERRLTPVAAGAAAPVE
FT                   KAPTAAVEPPRSTAATESPLLSSRARRLVAATSALGGLLILASFTAPWVYGGVAEAQFP
FT                   GPTAGLFIVAVAATVVAIAVIVDQPRGLVATGLGLGVALVAATSLLTPFGMLATDATSM
FT                   PTGLLLGVAGELLVVTAGIVTLASLLGSGQVSGAWAGLPDRRGLVGLGIVLVGSVTLML
FT                   YAGWLSDRPGSTWGAIMIVWAVTWLAAGAVATSTRPAALARAFLAGWAITALSQPVSDM
FT                   QYQYNGETFPAQPVVLLALLGLVVWAAVPSRERPAVSHRE"
     MSGTRRALIV ANDTYDHASL GQLRAPAADA EALADVLGDP EVGGFTVTVV HNEPSYEVQS        60
     RIEDAFADSR PDDLLLLHFS GHGLKSDTGE LFVAARNTRP DRLGSTAVSA DFIQRCMKTS       120
     RARSIVLFLD CCYGGAFGEG VTVRAAGPVN VMDSFPAERL GGGRGRAVIS ASSAIEYAFE       180
     GTALAADQTV RPSVFTSAVV EGLRTGDADR DEDGLVSLDE LYDYVFDRVR AENPKQTPGR       240
     DVEMAGDLYV ARSRRRRLRP APIPEAVAAA LKEANPTFRR GAVSELRDRL LHDDPAAALG       300
     ALEALRDVVR TDTKSVADDA AAALASARMT VVPVSIDLGG GGVGSEPRTG MVEVHGPALV       360
     QELTVQADPP LEAHVEDDGR VAVELPPGVE AFAGQLTITS PLGSVVVPVT ASPASVAGAA       420
     EQATEPGSDE TVRTTPQAET LVERRLTPVA AGAAAPVEKA PTAAVEPPRS TAATESPLLS       480
     SRARRLVAAT SALGGLLILA SFTAPWVYGG VAEAQFPGPT AGLFIVAVAA TVVAIAVIVD       540
     QPRGLVATGL GLGVALVAAT SLLTPFGMLA TDATSMPTGL LLGVAGELLV VTAGIVTLAS       600
     LLGSGQVSGA WAGLPDRRGL VGLGIVLVGS VTLMLYAGWL SDRPGSTWGA IMIVWAVTWL       660
     AAGAVATSTR PAALARAFLA GWAITALSQP VSDMQYQYNG ETFPAQPVVL LALLGLVVWA       720
     AVPSRERPAV SHRE                                                         734
//

If you have problems or comments...

PBIL Back to PBIL home page