(data stored in ACNUC7421 zone)

EMBL: CP002343.PE55

CP002343.PE55        Location/Qualifiers
FT   CDS             complement(62924..63904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0055"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018247; KEGG: bcv:Bcav_0018
FT                   mucin-associated surface protein (MASP); SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46617"
FT                   /db_xref="GOA:E6SEL6"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL6"
FT                   /protein_id="ADU46617.1"
FT                   /translation="MFRTKPTRSERLKMQVVEAREHAAATASELGHTAGERLAVMREQA
FT                   APVATDAAERVKLALDEAKLRAAPVAADLAERARPKVESAQSTLVDSLLPKVGAAIGVA
FT                   SAALAQGADEAKERMRDEPRVRHVRESARDHSDRVRDAYRVLSGEAVAKPVRHGRRTWL
FT                   IVIGLGAAAVAAVAAYRRQQADDPWATSSDGSLGGTGASTAFDASPSLKDKAAEKVGTA
FT                   KEAVTEAVTGAAAKAKDKATDLAAKGQAALADAKDRSSDDLVTDAEVEQASTWADEQLD
FT                   EPGATPWGNEGEVTAVDSTLGSDAIDGSVGTLPSETRGSTPKPKA"
     MFRTKPTRSE RLKMQVVEAR EHAAATASEL GHTAGERLAV MREQAAPVAT DAAERVKLAL        60
     DEAKLRAAPV AADLAERARP KVESAQSTLV DSLLPKVGAA IGVASAALAQ GADEAKERMR       120
     DEPRVRHVRE SARDHSDRVR DAYRVLSGEA VAKPVRHGRR TWLIVIGLGA AAVAAVAAYR       180
     RQQADDPWAT SSDGSLGGTG ASTAFDASPS LKDKAAEKVG TAKEAVTEAV TGAAAKAKDK       240
     ATDLAAKGQA ALADAKDRSS DDLVTDAEVE QASTWADEQL DEPGATPWGN EGEVTAVDST       300
     LGSDAIDGSV GTLPSETRGS TPKPKA                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page