(data stored in ACNUC7421 zone)

EMBL: CP002343.PE56

CP002343.PE56        Location/Qualifiers
FT   CDS             complement(64023..64613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_1730 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46618"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL7"
FT                   /protein_id="ADU46618.1"
FT                   /translation="MSFIDKLKQKADELGLKEKADHLAEEAKKVAEQAREKAGDLAAEN
FT                   RDKVGSVLDKAGAKLDEKTEGKYADKIAKAKEQVAKGVDKLAEGGTHGSGGAPASGAGA
FT                   AAAGAAAGAGAAAAGGAAATPDDFDIIPDEEEVAEEVLSVEVDPEAPLDGPPEPDVSLG
FT                   AGRPERAYDETGEPIDDLPLEPDAPDVPGSGRW"
     MSFIDKLKQK ADELGLKEKA DHLAEEAKKV AEQAREKAGD LAAENRDKVG SVLDKAGAKL        60
     DEKTEGKYAD KIAKAKEQVA KGVDKLAEGG THGSGGAPAS GAGAAAAGAA AGAGAAAAGG       120
     AAATPDDFDI IPDEEEVAEE VLSVEVDPEA PLDGPPEPDV SLGAGRPERA YDETGEPIDD       180
     LPLEPDAPDV PGSGRW                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page