(data stored in SCRATCH zone)

EMBL: CP002343.PE58

CP002343.PE58        Location/Qualifiers
FT   CDS             65326..66270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0058"
FT                   /product="Rhomboid family protein"
FT                   /note="COGs: COG0705 membrane protein; InterPro IPR002610;
FT                   KEGG: xce:Xcel_0012 rhomboid family protein; PFAM: Rhomboid
FT                   family protein; SPTR: Rhomboid family protein; PFAM:
FT                   Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46620"
FT                   /db_xref="GOA:E6SEL9"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL9"
FT                   /protein_id="ADU46620.1"
FT                   /translation="MSDSGTGAQPPIAPGAGQQPAGPSVCPRHPDREAYVKCQRCGRPA
FT                   CPECQRPAAVGIQCVDCVREAARTAPTTRTVFGGRPTDGRPIVTQAIIGICVVVFLVQW
FT                   VSPGTTVDYAFAPSAGWIEPWRFVTAMFLHAPRSLLHIGFNLYALFILGSYLEPLMGRA
FT                   RLAALYLISGIGGQVSVLLFAGNPTIEGLFNGTDAAWATPVVGASGAIFGLFGALIVLN
FT                   RHLGRSAAGMYGVLLINGVLGFVIPNISWQAHLGGFVTGLACAGAIVLFRRQRVRHLTW
FT                   LALSAVLALLVVISVGKYLTVPVEIRDLTAFRR"
     MSDSGTGAQP PIAPGAGQQP AGPSVCPRHP DREAYVKCQR CGRPACPECQ RPAAVGIQCV        60
     DCVREAARTA PTTRTVFGGR PTDGRPIVTQ AIIGICVVVF LVQWVSPGTT VDYAFAPSAG       120
     WIEPWRFVTA MFLHAPRSLL HIGFNLYALF ILGSYLEPLM GRARLAALYL ISGIGGQVSV       180
     LLFAGNPTIE GLFNGTDAAW ATPVVGASGA IFGLFGALIV LNRHLGRSAA GMYGVLLING       240
     VLGFVIPNIS WQAHLGGFVT GLACAGAIVL FRRQRVRHLT WLALSAVLAL LVVISVGKYL       300
     TVPVEIRDLT AFRR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page