(data stored in ACNUC7421 zone)

EMBL: CP002343.PE59

CP002343.PE59        Location/Qualifiers
FT   CDS             complement(66420..66671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0059"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="InterPro IPR009619; KEGG: bcv:Bcav_0021 protein of
FT                   unknown function UPF0233; PFAM: protein of unknown function
FT                   UPF0233; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterised protein family (UPF0233)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46621"
FT                   /db_xref="GOA:E6SEM0"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM0"
FT                   /protein_id="ADU46621.1"
FT                   /translation="MPESKGRDRKTAAYIPPPKSKATQPNPTWWAPAFVTLLVLGLLWI
FT                   VTYYITEYRYPISAIGVWNLAIGFALLMGGFIMTMRWR"
     MPESKGRDRK TAAYIPPPKS KATQPNPTWW APAFVTLLVL GLLWIVTYYI TEYRYPISAI        60
     GVWNLAIGFA LLMGGFIMTM RWR                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page