(data stored in ACNUC7421 zone)

EMBL: CP002343.PE63

CP002343.PE63        Location/Qualifiers
FT   CDS             complement(70137..71444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0063"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR017442: IPR020635: IPR002290: IPR008271: IPR
FT                   000719; KEGG: nca:Noca_0023 protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain; SPTR: Protein kinase; PFAM: Protein
FT                   kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46625"
FT                   /db_xref="GOA:E6SEM4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM4"
FT                   /protein_id="ADU46625.1"
FT                   /translation="MSTAFRPGHVLGSRYTLGAPIASGGMGDVWSATDDVLGREVAVKI
FT                   MRESHDPGYRDRFRDEARHSAALHHPNIAAVFDSGDDNDSPYLVMELVPGRPLSEIIAA
FT                   SKGQGFEPDTVRSIVGQAALALAAAHESGVVHRDVKPANIIVTPGGQAKLTDFGIARAG
FT                   EGKGHTITGEVLGTPEYLSPEQALGETASGASDLYSLGIIAHEMLTGAKPFDCGTPVAT
FT                   AVAQVNDEPPPLPLTVPEDLRAVVEACLVKDPDQRPTDARSLADALLAPLGGMPLSSSP
FT                   TTLSPQPSPTRTLPALSVADADVTGPGRAVDPAPRPTRAELRKRAQRHTEERGRPSVAW
FT                   LAVPFVALLIWGAFALGSLMGGADPTATLQQQPTAPPAVSTTSPTATAAPTVSRATTST
FT                   ATSTRAQAKPEPTAKAEPTVDPTRPGKGNGRGKGNK"
     MSTAFRPGHV LGSRYTLGAP IASGGMGDVW SATDDVLGRE VAVKIMRESH DPGYRDRFRD        60
     EARHSAALHH PNIAAVFDSG DDNDSPYLVM ELVPGRPLSE IIAASKGQGF EPDTVRSIVG       120
     QAALALAAAH ESGVVHRDVK PANIIVTPGG QAKLTDFGIA RAGEGKGHTI TGEVLGTPEY       180
     LSPEQALGET ASGASDLYSL GIIAHEMLTG AKPFDCGTPV ATAVAQVNDE PPPLPLTVPE       240
     DLRAVVEACL VKDPDQRPTD ARSLADALLA PLGGMPLSSS PTTLSPQPSP TRTLPALSVA       300
     DADVTGPGRA VDPAPRPTRA ELRKRAQRHT EERGRPSVAW LAVPFVALLI WGAFALGSLM       360
     GGADPTATLQ QQPTAPPAVS TTSPTATAAP TVSRATTSTA TSTRAQAKPE PTAKAEPTVD       420
     PTRPGKGNGR GKGNK                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page