(data stored in SCRATCH zone)

EMBL: CP002343.PE64

CP002343.PE64        Location/Qualifiers
FT   CDS             complement(71441..72904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0064"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro IPR001460;
FT                   KEGG: kse:Ksed_00200 cell division protein
FT                   FtsI/penicillin-binding protein 2; PFAM: penicillin-binding
FT                   protein transpeptidase; PRIAM: Peptidoglycan
FT                   glycosyltransferase; SPTR: PbpA; PFAM: Penicillin binding
FT                   protein transpeptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46626"
FT                   /db_xref="GOA:E6SEM5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM5"
FT                   /protein_id="ADU46626.1"
FT                   /translation="MNTAIRRLSVLIAALFGALLVASTVIQFVQAGSMRGMAANKRTLL
FT                   DNYAQERGSILVAGQPIAKSVEVDDQYRWLRTYPDGRLYSQITGFYAYSVGNPFGLEDA
FT                   ADDLLSGKADRLFVRRVTDLLTGRETAGATIELTIDPKVQQAASDALGKNRGAVVALDP
FT                   RTGAILAMVSHPQYDPNPLSSHDLDKAASAWKKLSTDRSKPFTNRAISGDLYPPGSTFK
FT                   VVTAAAALEQGIVDDESSMVPGPAALDLPLTDQPLPNETRQPCGPDDRTTLLHALEISC
FT                   NTAFGSLGLELGGEQLRAQAAKFGFGDSIQIPMRVSPSTMPAEMNQPQAAQSAIGQYEV
FT                   RTTPLQMAMIAAGIANQGRVMTPYLIQSVRTADLDVIDGPPDPKELSQAVSTRTADILK
FT                   RMMVSVVDNGSGRRAQIPGVAVGGKTGTAQHDLEKSPHAWFISFAPADDARVAVAVIVE
FT                   ESGVSGNEVGGAAVAAPIAKAVMEAVIGR"
     MNTAIRRLSV LIAALFGALL VASTVIQFVQ AGSMRGMAAN KRTLLDNYAQ ERGSILVAGQ        60
     PIAKSVEVDD QYRWLRTYPD GRLYSQITGF YAYSVGNPFG LEDAADDLLS GKADRLFVRR       120
     VTDLLTGRET AGATIELTID PKVQQAASDA LGKNRGAVVA LDPRTGAILA MVSHPQYDPN       180
     PLSSHDLDKA ASAWKKLSTD RSKPFTNRAI SGDLYPPGST FKVVTAAAAL EQGIVDDESS       240
     MVPGPAALDL PLTDQPLPNE TRQPCGPDDR TTLLHALEIS CNTAFGSLGL ELGGEQLRAQ       300
     AAKFGFGDSI QIPMRVSPST MPAEMNQPQA AQSAIGQYEV RTTPLQMAMI AAGIANQGRV       360
     MTPYLIQSVR TADLDVIDGP PDPKELSQAV STRTADILKR MMVSVVDNGS GRRAQIPGVA       420
     VGGKTGTAQH DLEKSPHAWF ISFAPADDAR VAVAVIVEES GVSGNEVGGA AVAAPIAKAV       480
     MEAVIGR                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page