(data stored in SCRATCH zone)

EMBL: CP002343.PE65

CP002343.PE65        Location/Qualifiers
FT   CDS             complement(72901..74292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0065"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="COGs: COG0772 Bacterial cell division membrane
FT                   protein; InterPro IPR001182; KEGG: kra:Krad_0074 cell cycle
FT                   protein; PFAM: cell cycle protein; SPTR: Putative
FT                   FtsW/RodA/SpoVE family cell cycle protein; PFAM: Cell cycle
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46627"
FT                   /db_xref="GOA:E6SEM6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM6"
FT                   /protein_id="ADU46627.1"
FT                   /translation="MTTTVEPVTPRTRRGVELVLLIVAIAVVLLAWVTVDLNRNGTVPA
FT                   EIIPVAGGLVVLAGVVHVVLRWKAPYADPVLLPITTALNGLGLVMIHRLDLAAGRLGAD
FT                   GNANQQIIWTALAVALTVAAIWTLRDHRLLRRYTFISLAVGFILLTLPLVPGLGREVNG
FT                   SRIWIAVGPFSFQPGEFAKIALAVFFAGYLVQTRDVLSLAGKRVLGFTFPRGRDLGPIL
FT                   VAWVLALLILVFEKDLGSALLFFGLFVAMLYVATERVSWIAIGLLLFGAAVAFALSAFA
FT                   HFQKRVDLWLDPFSTENLERSNQLANGLWGMAAGGLTGTGLGAGRPWLTPFAESDYIFA
FT                   SLAEELGLIGAVGILMLYLLFVERGVRTALGVRDGFGKLLAIGLTFSVAFQLFIVIGGV
FT                   TRLIPLTGLTTPFLSLGGSSLLANWIIMSLLLRISDQARRPVPALPIGVGADPATAEAT
FT                   QVVRL"
     MTTTVEPVTP RTRRGVELVL LIVAIAVVLL AWVTVDLNRN GTVPAEIIPV AGGLVVLAGV        60
     VHVVLRWKAP YADPVLLPIT TALNGLGLVM IHRLDLAAGR LGADGNANQQ IIWTALAVAL       120
     TVAAIWTLRD HRLLRRYTFI SLAVGFILLT LPLVPGLGRE VNGSRIWIAV GPFSFQPGEF       180
     AKIALAVFFA GYLVQTRDVL SLAGKRVLGF TFPRGRDLGP ILVAWVLALL ILVFEKDLGS       240
     ALLFFGLFVA MLYVATERVS WIAIGLLLFG AAVAFALSAF AHFQKRVDLW LDPFSTENLE       300
     RSNQLANGLW GMAAGGLTGT GLGAGRPWLT PFAESDYIFA SLAEELGLIG AVGILMLYLL       360
     FVERGVRTAL GVRDGFGKLL AIGLTFSVAF QLFIVIGGVT RLIPLTGLTT PFLSLGGSSL       420
     LANWIIMSLL LRISDQARRP VPALPIGVGA DPATAEATQV VRL                         463
//

If you have problems or comments...

PBIL Back to PBIL home page