(data stored in ACNUC7421 zone)

EMBL: CP002343.PE66

CP002343.PE66        Location/Qualifiers
FT   CDS             complement(74289..75752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0066"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG0631 Serine/threonine protein phosphatase;
FT                   InterPro IPR014045: IPR001932; KEGG: kra:Krad_0075 protein
FT                   phosphatase 2C-like; PFAM: Protein phosphatase 2C-like;
FT                   SMART: protein phosphatase 2C domain protein; SPTR:
FT                   Putative magnesium or manganese-dependent protein
FT                   phosphatase; PFAM: Protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46628"
FT                   /db_xref="GOA:E6SEM7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM7"
FT                   /protein_id="ADU46628.1"
FT                   /translation="MAIALRYAARSDLGLGPKSRNEDSGYAGPNLLVLADGMGGHAAGD
FT                   VASSMIVGELAPLDDEDIGADQAIPLLERSLRSANARLTRAMRENSDLAGMGSTTIVML
FT                   RTGNKIAMAHIGDSRAFMLRGDSFSQITKDHSFVQQLVDEGRISKEEAGSHPQRSVVTR
FT                   VMTGQPDDDPDTSLREAKVGDRFLLCSDGLSDFVGADVIEEILAGAASPEEAADRCVEV
FT                   ALKAHTRDNVTVIVADVVDPDGDDLPTTVPQVVGAAARSLRDKTKAIPTTPAEKAAALS
FT                   REALGQKERVDPAPELAESTRRSRRSRGLRRALATLVVLGILVGGGYAAWAWSQQQFYV
FT                   GADAGQVAIFRGVDGEIGPIDLSGIEVRSDVVVTELPSDVQAAVSRTIPAADLADARAK
FT                   VDRLRAEALRCRGLATTGIPCGDTPVTTPTPTPTTPTSPSTPPSTAPIPTSSTTSTTPT
FT                   TAPAPNAAPTPGPSQPARAALGSSTEVVG"
     MAIALRYAAR SDLGLGPKSR NEDSGYAGPN LLVLADGMGG HAAGDVASSM IVGELAPLDD        60
     EDIGADQAIP LLERSLRSAN ARLTRAMREN SDLAGMGSTT IVMLRTGNKI AMAHIGDSRA       120
     FMLRGDSFSQ ITKDHSFVQQ LVDEGRISKE EAGSHPQRSV VTRVMTGQPD DDPDTSLREA       180
     KVGDRFLLCS DGLSDFVGAD VIEEILAGAA SPEEAADRCV EVALKAHTRD NVTVIVADVV       240
     DPDGDDLPTT VPQVVGAAAR SLRDKTKAIP TTPAEKAAAL SREALGQKER VDPAPELAES       300
     TRRSRRSRGL RRALATLVVL GILVGGGYAA WAWSQQQFYV GADAGQVAIF RGVDGEIGPI       360
     DLSGIEVRSD VVVTELPSDV QAAVSRTIPA ADLADARAKV DRLRAEALRC RGLATTGIPC       420
     GDTPVTTPTP TPTTPTSPST PPSTAPIPTS STTSTTPTTA PAPNAAPTPG PSQPARAALG       480
     SSTEVVG                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page