(data stored in ACNUC7421 zone)

EMBL: CP002343.PE69

CP002343.PE69        Location/Qualifiers
FT   CDS             77359..78924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0069"
FT                   /product="chromosome partitioning ATPase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; KEGG: bfa:Bfae_03240 chromosome partitioning
FT                   ATPase; SPTR: ATPase involved in chromosome partitioning;
FT                   PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN0"
FT                   /protein_id="ADU46631.1"
FT                   /translation="MSNDDSGGAKGQGIPGYSANNTIPGGFSLPLPTATNSAADAVAEA
FT                   PEPADPWSSTWDDTSWQLPEPDSSVSLYSRDELSQYAGTDHGDRSDWADSYDHGGDQAG
FT                   APRTGALSGWDAWEPSGASGFNPDTGHWSDLQHNDETAARSAEEYSGWTPAGSPAPAPL
FT                   NGLHHPGVHVAAVQAHAATPPIDPDVAAAAVELGHDPGSAAYGPEPLVHVDHERPNADD
FT                   LITVRSKGERQKVKASSGLRRAFGLGPGLRELLERDRIDRIARPLSGRKTIMVINTKGG
FT                   GGKTLVTLMLASYLGRYRSGSVLAWDNNETEGTLGMRAPSQSHHRTVVDLLGALPSIAA
FT                   DPNAGTSELEHWVREQRGLSFDVLASADDDEAMRVIGEQEFEDLHTQLSRFYRMIVVDT
FT                   GNNRLSPNWLAAAARADMLVFATSLKDDTSVVAAKNLDALVAMGRGDLVKNAVCVISHT
FT                   TAKGNDVGAGVHTREHFEQWVRAVVDIPYDPALAPGLHLDPLKISRKTHESCMEMTATV
FT                   VDGL"
     MSNDDSGGAK GQGIPGYSAN NTIPGGFSLP LPTATNSAAD AVAEAPEPAD PWSSTWDDTS        60
     WQLPEPDSSV SLYSRDELSQ YAGTDHGDRS DWADSYDHGG DQAGAPRTGA LSGWDAWEPS       120
     GASGFNPDTG HWSDLQHNDE TAARSAEEYS GWTPAGSPAP APLNGLHHPG VHVAAVQAHA       180
     ATPPIDPDVA AAAVELGHDP GSAAYGPEPL VHVDHERPNA DDLITVRSKG ERQKVKASSG       240
     LRRAFGLGPG LRELLERDRI DRIARPLSGR KTIMVINTKG GGGKTLVTLM LASYLGRYRS       300
     GSVLAWDNNE TEGTLGMRAP SQSHHRTVVD LLGALPSIAA DPNAGTSELE HWVREQRGLS       360
     FDVLASADDD EAMRVIGEQE FEDLHTQLSR FYRMIVVDTG NNRLSPNWLA AAARADMLVF       420
     ATSLKDDTSV VAAKNLDALV AMGRGDLVKN AVCVISHTTA KGNDVGAGVH TREHFEQWVR       480
     AVVDIPYDPA LAPGLHLDPL KISRKTHESC MEMTATVVDG L                           521
//

If you have problems or comments...

PBIL Back to PBIL home page