(data stored in ACNUC7421 zone)

EMBL: CP002343.PE7

CP002343.PE7         Location/Qualifiers
FT   CDS             complement(8714..10039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ske:Sked_09010 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46569"
FT                   /db_xref="GOA:E6SDW6"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW6"
FT                   /protein_id="ADU46569.1"
FT                   /translation="MNTTDPRLKDLFAERSQRVHVVGDLAERAIARDRANRRREVTTAV
FT                   AVGAVALAVAVPVGWNATRPDSVRPVPAVSTSGGLTSTEPAPSPSQSTSQSTTTDQPTD
FT                   RPTSIPTITLSGAPAPATLAPSADPSGPAGDTAVAYVIDGELHDGLSRITLPDALARPA
FT                   QVARLADRLVLLVTDDGVTVVDASGAVLTDLPGGRAVAVSSDRTHFILTGDTGDLTYHD
FT                   ARGRQLAQLPAATCKCGSDGGAPSAYQAAVGLVGTTAYAAKGYTGTTVAWDVETGATKD
FT                   LPGQFRMVDSERAVAVVQIGGATGENPCYDLRDLATNARRWRVCGPVLMQSFSLDGQYV
FT                   VGTGAVDGLRSSVTYPTVLVWRTTDGELLLESGDPTGPGPWSVSARAATGQDIAVQVGH
FT                   EDGTRSLQRCTLEGRCEVIAPARPRWQSDIPEGDDPYILATN"
     MNTTDPRLKD LFAERSQRVH VVGDLAERAI ARDRANRRRE VTTAVAVGAV ALAVAVPVGW        60
     NATRPDSVRP VPAVSTSGGL TSTEPAPSPS QSTSQSTTTD QPTDRPTSIP TITLSGAPAP       120
     ATLAPSADPS GPAGDTAVAY VIDGELHDGL SRITLPDALA RPAQVARLAD RLVLLVTDDG       180
     VTVVDASGAV LTDLPGGRAV AVSSDRTHFI LTGDTGDLTY HDARGRQLAQ LPAATCKCGS       240
     DGGAPSAYQA AVGLVGTTAY AAKGYTGTTV AWDVETGATK DLPGQFRMVD SERAVAVVQI       300
     GGATGENPCY DLRDLATNAR RWRVCGPVLM QSFSLDGQYV VGTGAVDGLR SSVTYPTVLV       360
     WRTTDGELLL ESGDPTGPGP WSVSARAATG QDIAVQVGHE DGTRSLQRCT LEGRCEVIAP       420
     ARPRWQSDIP EGDDPYILAT N                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page