(data stored in ACNUC7421 zone)

EMBL: CP002343.PE70

CP002343.PE70        Location/Qualifiers
FT   CDS             79448..80131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0070"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="COGs: COG2802 Uncharacterized protein similar to the
FT                   N-terminal domain of Lon protease; InterPro IPR003111;
FT                   KEGG: kra:Krad_3182 peptidase S16 lon domain protein; PFAM:
FT                   peptidase S16 lon domain protein; SMART: peptidase S16 lon
FT                   domain protein; SPTR: Peptidase S16 lon domain protein;
FT                   PFAM: ATP-dependent protease La (LON) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46632"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN1"
FT                   /protein_id="ADU46632.1"
FT                   /translation="MASLPLFPLGAVLLPGARLPLQVFEPRYVALLRDLIAAQDEHSPV
FT                   FGIIAIREGNEVGEGAVRSLYDVGCGALLTHVAALGGQRFFVIVEGTDRFRLGTVDRTA
FT                   GTRYTTAQVSWLDEPDGDPAAIAPLAGRLRAELEAFRELARVAQQRAGDPGAGEVVIPQ
FT                   VPRALAYAVPLIVSLDLADRQRLLECPDTESRLRLGLELTHRERELAHALGATLKAPQS
FT                   PFDLS"
     MASLPLFPLG AVLLPGARLP LQVFEPRYVA LLRDLIAAQD EHSPVFGIIA IREGNEVGEG        60
     AVRSLYDVGC GALLTHVAAL GGQRFFVIVE GTDRFRLGTV DRTAGTRYTT AQVSWLDEPD       120
     GDPAAIAPLA GRLRAELEAF RELARVAQQR AGDPGAGEVV IPQVPRALAY AVPLIVSLDL       180
     ADRQRLLECP DTESRLRLGL ELTHRERELA HALGATLKAP QSPFDLS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page