(data stored in ACNUC7421 zone)

EMBL: CP002343.PE71

CP002343.PE71        Location/Qualifiers
FT   CDS             complement(80224..80931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3859 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46633"
FT                   /db_xref="GOA:E6SEN2"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN2"
FT                   /protein_id="ADU46633.1"
FT                   /translation="MDWMDQLVARLEPATGDVTLTAAAVWTVLAGSLLVVAVEPLWRVL
FT                   RIAVTLVHELGHAVVGMAVGRRFTGFVLRGDMSGHAVTVGRPRGPGRVVSTWAGYPAPA
FT                   LVGAAMAWLAGRGWAAAFIAGVIVVLLVALVRVRSALTLLVMLVALAATGALWWWRDDV
FT                   LQAQLLVGTGIVLVVGAWRHLAAVAGSRDRSSDPGVLASLTHIPGVVWTLSFALACAAG
FT                   SWLLAVEVLTALR"
     MDWMDQLVAR LEPATGDVTL TAAAVWTVLA GSLLVVAVEP LWRVLRIAVT LVHELGHAVV        60
     GMAVGRRFTG FVLRGDMSGH AVTVGRPRGP GRVVSTWAGY PAPALVGAAM AWLAGRGWAA       120
     AFIAGVIVVL LVALVRVRSA LTLLVMLVAL AATGALWWWR DDVLQAQLLV GTGIVLVVGA       180
     WRHLAAVAGS RDRSSDPGVL ASLTHIPGVV WTLSFALACA AGSWLLAVEV LTALR            235
//

If you have problems or comments...

PBIL Back to PBIL home page