(data stored in ACNUC7421 zone)

EMBL: CP002343.PE74

CP002343.PE74        Location/Qualifiers
FT   CDS             83226..84536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0074"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   pak:HMPREF0675_5030 bacterial extracellular solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: Bacterial extracellular solute-binding protein;
FT                   PFAM: Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46636"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN5"
FT                   /protein_id="ADU46636.1"
FT                   /translation="MRNRSVATVAIATIAALGLAACGSSNEPTPTPGGDTSSLATTSGG
FT                   AGGEVGVFTWWAAGSEKKGLDELEKLFKEKYPNDTFVNLAVAGGAGSNAKAKLASDLQN
FT                   NQPPGSFQGHAGAELLDYIDAEQIEPVNDVIAALGGDKVFPKSLLDRLTVDGNIYSVPS
FT                   NIHRANVVWANTEVLKNAGINAVPTDIKGWIADMEKVKASGVATPLSVAGTWTQLQLFE
FT                   TVLISDLGVDKYNGLFDGKTAWDSPEVKQAAADYKTLLTYANTASDGDDWPVATDMVID
FT                   GKAAYNVMGDWAVAEFAAKGKKEQTDYQYFAVPGQEGVFDFLADSFTLPKGTKNPGGTK
FT                   DWLMLIGSAEGQKAFNLAKGSIPARTDVPATDFPPYQQSAMEAFKTNDIVSSIAHGAAV
FT                   SLAWNADMSTAISKFYTTKDDAGLVTDLTAAAKKYLP"
     MRNRSVATVA IATIAALGLA ACGSSNEPTP TPGGDTSSLA TTSGGAGGEV GVFTWWAAGS        60
     EKKGLDELEK LFKEKYPNDT FVNLAVAGGA GSNAKAKLAS DLQNNQPPGS FQGHAGAELL       120
     DYIDAEQIEP VNDVIAALGG DKVFPKSLLD RLTVDGNIYS VPSNIHRANV VWANTEVLKN       180
     AGINAVPTDI KGWIADMEKV KASGVATPLS VAGTWTQLQL FETVLISDLG VDKYNGLFDG       240
     KTAWDSPEVK QAAADYKTLL TYANTASDGD DWPVATDMVI DGKAAYNVMG DWAVAEFAAK       300
     GKKEQTDYQY FAVPGQEGVF DFLADSFTLP KGTKNPGGTK DWLMLIGSAE GQKAFNLAKG       360
     SIPARTDVPA TDFPPYQQSA MEAFKTNDIV SSIAHGAAVS LAWNADMSTA ISKFYTTKDD       420
     AGLVTDLTAA AKKYLP                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page