(data stored in SCRATCH zone)

EMBL: CP002343.PE75

CP002343.PE75        Location/Qualifiers
FT   CDS             84635..85549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0075"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG: pac:PPA1965
FT                   binding-protein-dependent transport permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   permease; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46637"
FT                   /db_xref="GOA:E6SEN6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN6"
FT                   /protein_id="ADU46637.1"
FT                   /translation="MRTATKVRDWLPGFLLVLPSVIVVGIFVYWLILQNVLTSLDRTVT
FT                   RATKRVTNPGGVENYTNLLGDDGYQHALFNLLVLTVVFVAGTMVFGLLWAVLLEKGVNA
FT                   EGVFRSVYLLPMAISFIAAGIVWRWLLSPGKGEQAVGLNQLLAMMGLERFQSSWWQSPN
FT                   TLSMAAMAIPAIWQLSGYVMALFLAGFRGISDDQREAARIDGATERQIYRHVLFPQLSP
FT                   IALSALIIIGHMSMKMFDLIYAIAGQNSYKASVPATLMWTQMFQQNNPTAAAANATILL
FT                   VLVALVVVPYLIYTNKTEKETRG"
     MRTATKVRDW LPGFLLVLPS VIVVGIFVYW LILQNVLTSL DRTVTRATKR VTNPGGVENY        60
     TNLLGDDGYQ HALFNLLVLT VVFVAGTMVF GLLWAVLLEK GVNAEGVFRS VYLLPMAISF       120
     IAAGIVWRWL LSPGKGEQAV GLNQLLAMMG LERFQSSWWQ SPNTLSMAAM AIPAIWQLSG       180
     YVMALFLAGF RGISDDQREA ARIDGATERQ IYRHVLFPQL SPIALSALII IGHMSMKMFD       240
     LIYAIAGQNS YKASVPATLM WTQMFQQNNP TAAAANATIL LVLVALVVVP YLIYTNKTEK       300
     ETRG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page