(data stored in ACNUC7421 zone)

EMBL: CP002343.PE76

CP002343.PE76        Location/Qualifiers
FT   CDS             85546..86472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0076"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG:
FT                   pak:HMPREF0675_5028 ABC transporter, permease protein;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; SPTR: Binding-protein-dependent
FT                   transport permease; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46638"
FT                   /db_xref="GOA:E6SEN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN7"
FT                   /protein_id="ADU46638.1"
FT                   /translation="MTTATAQTAPVAPGTDALGVRVSTGKAPGTEGTALGRTLRYALLI
FT                   LFVILILIPLYVLFVTSFKRSGDVNASQAWTFPSAWSIDGWRAAWDSLSPALFRSVILA
FT                   TSVAVLSASLGSLNGFVFAKWRFPGATTIFTLFLFGMFIPYQAVMIPLQGMLLDVQGTP
FT                   GFSWFDGIAKLIAVHVIFGIPICTLIFRNYYATALPNEILEAAKVDGAGMLRTFRSIVL
FT                   PISAPGFVVTMIWQFTSAWNDFLFALFLTNRNTGPVTYALNELAGGQNPDYPSIMAGVL
FT                   LASLPTLLVYILLGRYFIGGLMSGSVK"
     MTTATAQTAP VAPGTDALGV RVSTGKAPGT EGTALGRTLR YALLILFVIL ILIPLYVLFV        60
     TSFKRSGDVN ASQAWTFPSA WSIDGWRAAW DSLSPALFRS VILATSVAVL SASLGSLNGF       120
     VFAKWRFPGA TTIFTLFLFG MFIPYQAVMI PLQGMLLDVQ GTPGFSWFDG IAKLIAVHVI       180
     FGIPICTLIF RNYYATALPN EILEAAKVDG AGMLRTFRSI VLPISAPGFV VTMIWQFTSA       240
     WNDFLFALFL TNRNTGPVTY ALNELAGGQN PDYPSIMAGV LLASLPTLLV YILLGRYFIG       300
     GLMSGSVK                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page