(data stored in SCRATCH zone)

EMBL: CP002343.PE78

CP002343.PE78        Location/Qualifiers
FT   CDS             87199..87957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0078"
FT                   /product="Abortive infection protein"
FT                   /note="InterPro IPR003675: IPR015837; KEGG: sna:Snas_2427
FT                   abortive infection protein; PFAM: Abortive infection
FT                   protein; SPTR: Abortive infection protein; PFAM: CAAX amino
FT                   terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46640"
FT                   /db_xref="GOA:E6SEN9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR015837"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN9"
FT                   /protein_id="ADU46640.1"
FT                   /translation="MNATLEPMTVAAATRPVPPRRRPGLWATVVVVLVLVGLNLANHVF
FT                   GWGSLWLGPTGAVALLAFARFSGLTWRQLGLSRRTHASGLRWGLGVIGVVALVYLVGVL
FT                   VPQTRTAFLDARYHLPPASALLTAFVIIPVGTILLEEVAFRSVLWGFLSRHARVWQVAL
FT                   GSSLLFGLWHVLPASAAVTANPALGAVMVGLGAWQQVVSVAGTVLFTALGGLVAGELRR
FT                   RSGSILASVGMHWATNALGVLFGLVAWQLA"
     MNATLEPMTV AAATRPVPPR RRPGLWATVV VVLVLVGLNL ANHVFGWGSL WLGPTGAVAL        60
     LAFARFSGLT WRQLGLSRRT HASGLRWGLG VIGVVALVYL VGVLVPQTRT AFLDARYHLP       120
     PASALLTAFV IIPVGTILLE EVAFRSVLWG FLSRHARVWQ VALGSSLLFG LWHVLPASAA       180
     VTANPALGAV MVGLGAWQQV VSVAGTVLFT ALGGLVAGEL RRRSGSILAS VGMHWATNAL       240
     GVLFGLVAWQ LA                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page