(data stored in ACNUC7421 zone)

EMBL: CP002343.PE79

CP002343.PE79        Location/Qualifiers
FT   CDS             complement(87966..89321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_36620 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46641"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP0"
FT                   /protein_id="ADU46641.1"
FT                   /translation="MLVPPTATFDDFGLGVDLALGRWDITRPRSFRTGWHGRHERRGAG
FT                   PGDLPPDRLVHVAVAKGTQFEYLFDDDEKWIHECVVEELVGRRLTDGRPPIPVPLLGWG
FT                   SVPDQFGRTSPEEVGLLGPEGSATDPATHPAADAATDPATDAANDSATGPQTGSAATPE
FT                   GESAPPRGRPTRAGKGSAPATGTPGATGGIERAPEPGSAGGPAAEGQRRHRGAAKPLDL
FT                   AAVRSGSRSADVGALLSSIEGRDLGPALQQVGDALLRTYRSAGTVDQRRLVGSLREIET
FT                   LLGDRGWEGDDVLAEEIGALLSGSERRGRTLNVDIEELSEVMGNGGADPGGYLHLDTGE
FT                   VVHAFLHHSMEDLDTPGLQEKEEAGREVDNLWIYVDHDTEAAYADMEAFAQAVSDRFAG
FT                   ILTVAIRGKGAFARFRRTVDELDLWGEWQVFSDDRAFGRARALLRSQGIRPV"
     MLVPPTATFD DFGLGVDLAL GRWDITRPRS FRTGWHGRHE RRGAGPGDLP PDRLVHVAVA        60
     KGTQFEYLFD DDEKWIHECV VEELVGRRLT DGRPPIPVPL LGWGSVPDQF GRTSPEEVGL       120
     LGPEGSATDP ATHPAADAAT DPATDAANDS ATGPQTGSAA TPEGESAPPR GRPTRAGKGS       180
     APATGTPGAT GGIERAPEPG SAGGPAAEGQ RRHRGAAKPL DLAAVRSGSR SADVGALLSS       240
     IEGRDLGPAL QQVGDALLRT YRSAGTVDQR RLVGSLREIE TLLGDRGWEG DDVLAEEIGA       300
     LLSGSERRGR TLNVDIEELS EVMGNGGADP GGYLHLDTGE VVHAFLHHSM EDLDTPGLQE       360
     KEEAGREVDN LWIYVDHDTE AAYADMEAFA QAVSDRFAGI LTVAIRGKGA FARFRRTVDE       420
     LDLWGEWQVF SDDRAFGRAR ALLRSQGIRP V                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page