(data stored in SCRATCH zone)

EMBL: CP002343.PE8

CP002343.PE8         Location/Qualifiers
FT   CDS             complement(10036..10545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0008"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR007627: IPR013249: IPR014325: IPR014284; KEGG:
FT                   nca:Noca_3654 sigma-70, region 4 type 2; PFAM: Sigma-70
FT                   region 4 type 2; sigma-70 region 2 domain protein; SPTR:
FT                   Sigma-70, region 4 type 2; TIGRFAM: RNA polymerase sigma-70
FT                   factor, sigma-E family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   2; TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   RNA polymerase sigma-70 factor, sigma-E family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46570"
FT                   /db_xref="GOA:E6SDW7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW7"
FT                   /protein_id="ADU46570.1"
FT                   /translation="MDDAARSADFTAYVRAREQALARLAYLLTGDRDAAEDLLQNALAK
FT                   CYRHWDRIRAVEQPDAYVRRVMVNERNSRWRSLLRRRESAGSHLLEVFDPPATSVGLDP
FT                   GESLDLWRHVQTLPTQQRAVVVLRFYEDLTEAQTAAILGCTVGTVKSHTSRALAAMRLK
FT                   MSEAPA"
     MDDAARSADF TAYVRAREQA LARLAYLLTG DRDAAEDLLQ NALAKCYRHW DRIRAVEQPD        60
     AYVRRVMVNE RNSRWRSLLR RRESAGSHLL EVFDPPATSV GLDPGESLDL WRHVQTLPTQ       120
     QRAVVVLRFY EDLTEAQTAA ILGCTVGTVK SHTSRALAAM RLKMSEAPA                   169
//

If you have problems or comments...

PBIL Back to PBIL home page