(data stored in ACNUC7421 zone)

EMBL: CP002343.PE80

CP002343.PE80        Location/Qualifiers
FT   CDS             complement(89441..90604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0080"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611; KEGG: art:Arth_2897 ribokinase-like
FT                   domain-containing protein; PFAM: PfkB domain protein; SPTR:
FT                   Putative carbohydrate kinase; PFAM: pfkB family
FT                   carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46642"
FT                   /db_xref="GOA:E6SEP1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP1"
FT                   /protein_id="ADU46642.1"
FT                   /translation="MKGMPQNAYDPLASRRSPDAPEVDVFVWGTVFLDLVFAGLPTAPK
FT                   PGTEVWSEGLASCPGGIANLAVATRRLGLRTSLAAAFSDDDYGDFCWRTLEEQEGIDLC
FT                   RSRQFPEWHSPVTVSMAFGGDRAMVSHGHPPPVSSLELIGDPPRSRAVMVDLAESGLFE
FT                   PGDGTRGLGSAARAGESWVDAARRRGALVFADVGWDRDERWEPSVLDRLSHCDAFLPNA
FT                   IEAMAYTATSSPQEALFALADRVPIAVVTNGAEGALGIDARTGEEAQVPSLRVHEVDAT
FT                   GVGDVFAAAMLVGTLGEWPLADRMSFASLAAALALQQYGGSLAAPGWGDVADWWTGLCS
FT                   DACGDAYHRSLRRRYAFLDDIVPRVPVTACRRATATIARRADVDDLP"
     MKGMPQNAYD PLASRRSPDA PEVDVFVWGT VFLDLVFAGL PTAPKPGTEV WSEGLASCPG        60
     GIANLAVATR RLGLRTSLAA AFSDDDYGDF CWRTLEEQEG IDLCRSRQFP EWHSPVTVSM       120
     AFGGDRAMVS HGHPPPVSSL ELIGDPPRSR AVMVDLAESG LFEPGDGTRG LGSAARAGES       180
     WVDAARRRGA LVFADVGWDR DERWEPSVLD RLSHCDAFLP NAIEAMAYTA TSSPQEALFA       240
     LADRVPIAVV TNGAEGALGI DARTGEEAQV PSLRVHEVDA TGVGDVFAAA MLVGTLGEWP       300
     LADRMSFASL AAALALQQYG GSLAAPGWGD VADWWTGLCS DACGDAYHRS LRRRYAFLDD       360
     IVPRVPVTAC RRATATIARR ADVDDLP                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page