(data stored in ACNUC7421 zone)

EMBL: CP002343.PE81

CP002343.PE81        Location/Qualifiers
FT   CDS             90606..91670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0081"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2951 Membrane-bound lytic murein
FT                   transglycosylase B; KEGG: sgr:SGR_1028 hypothetical
FT                   protein; SPTR: Lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46643"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP2"
FT                   /protein_id="ADU46643.1"
FT                   /translation="MAQPGREVPWFSGFGPPGRLSPGNRAMAYAAGPEVSAAIPEQSDR
FT                   PPRIVDEVGVGSSRTKRAAGGAGGVAVLLCSVLTAPALAADTSPVPRPSPGAPVASQGV
FT                   ADPVAPVPPVAPIDPLGSGAGESLLRLYDVVKVTAGYVAATRLEPGGGSSRPGRDSAWQ
FT                   PPADLQTPPVTPGTAAGPGRRMTKYDVLGAAYQKAADALADSCQLPFAVLMAIGEVESG
FT                   SLRGRTLDVRHNVVPPIIGPALSGSGFAAIRDSDRGRLDGDPVWDRAVGPMQFIPGTWR
FT                   LWGADGNGDGVADPQNVEDAALSAGRYLCAGGRDLARQADLERAILSYNHSRRYLETVL
FT                   DLYDSVMGGAVAGP"
     MAQPGREVPW FSGFGPPGRL SPGNRAMAYA AGPEVSAAIP EQSDRPPRIV DEVGVGSSRT        60
     KRAAGGAGGV AVLLCSVLTA PALAADTSPV PRPSPGAPVA SQGVADPVAP VPPVAPIDPL       120
     GSGAGESLLR LYDVVKVTAG YVAATRLEPG GGSSRPGRDS AWQPPADLQT PPVTPGTAAG       180
     PGRRMTKYDV LGAAYQKAAD ALADSCQLPF AVLMAIGEVE SGSLRGRTLD VRHNVVPPII       240
     GPALSGSGFA AIRDSDRGRL DGDPVWDRAV GPMQFIPGTW RLWGADGNGD GVADPQNVED       300
     AALSAGRYLC AGGRDLARQA DLERAILSYN HSRRYLETVL DLYDSVMGGA VAGP             354
//

If you have problems or comments...

PBIL Back to PBIL home page