(data stored in ACNUC7421 zone)

EMBL: CP002343.PE82

CP002343.PE82        Location/Qualifiers
FT   CDS             91765..93507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0082"
FT                   /product="Sulfite reductase (ferredoxin)"
FT                   /EC_number="1.8.7.1"
FT                   /note="COGs: COG0155 Sulfite reductase beta subunit
FT                   (hemoprotein); InterPro IPR005117: IPR006067: IPR006066;
FT                   KEGG: xce:Xcel_0718 sulfite reductase (ferredoxin); PFAM:
FT                   nitrite and sulphite reductase 4Fe-4S region;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; PRIAM: Sulfite reductase
FT                   (ferredoxin); SPTR: Sulfite reductase (Ferredoxin); PFAM:
FT                   Nitrite and sulphite reductase 4Fe-4S domain;
FT                   Nitrite/Sulfite reductase ferredoxin-like half domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46644"
FT                   /db_xref="GOA:E6SEP3"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP3"
FT                   /protein_id="ADU46644.1"
FT                   /translation="MTVTEIPGATTPARPAARPPRADRSNGQWKVDGLEPLNANEVWKQ
FT                   EEGGLAVRERIEKTYAKEGFGAIPAQDLTGRFRWWGLYTQRKPGIDGGRTAQLSDDELS
FT                   DTYFMLRVRTDGQALPPEALRVLGGISVDFARGSADITDRQNIQYHWIAIEDVPEIWRR
FT                   LESVGLETTTACGDTPRGFLGSPVAGIAADEIIDPTPVILEIKRRWIGNPELANLPRKF
FT                   KTAITGHPSLDVVHEINDISLVGVVHPELGPGYDLWVGGGLSTSPRLAERLGVFVSEDE
FT                   AAEVWHGVIQIFRDYGFRRLRNKARLKFLLADWGVEKFRHVLETEYLGHALPDGPAPKP
FT                   ATGPGDHVGVHLQKDGRYYVGAAPVVGRVGGPVLSGLADLIDEVGAGRVRLTAHQKLVI
FT                   LDVPEAGVERLVEGLEGLGLTARPSPFRRTTMACTGIEFCKLAIVETKDTAAAAITELE
FT                   RRLADVVADGSLDEPIQLNVNGCPNSCARIQTADIGLKGQIVTVDGPDGPVQQAGFQVH
FT                   LGGGLSTVERDEAGLGRTVRGLKVTAAELPDYVERVIRSFIARRSEGETFAAWALRAED
FT                   GELL"
     MTVTEIPGAT TPARPAARPP RADRSNGQWK VDGLEPLNAN EVWKQEEGGL AVRERIEKTY        60
     AKEGFGAIPA QDLTGRFRWW GLYTQRKPGI DGGRTAQLSD DELSDTYFML RVRTDGQALP       120
     PEALRVLGGI SVDFARGSAD ITDRQNIQYH WIAIEDVPEI WRRLESVGLE TTTACGDTPR       180
     GFLGSPVAGI AADEIIDPTP VILEIKRRWI GNPELANLPR KFKTAITGHP SLDVVHEIND       240
     ISLVGVVHPE LGPGYDLWVG GGLSTSPRLA ERLGVFVSED EAAEVWHGVI QIFRDYGFRR       300
     LRNKARLKFL LADWGVEKFR HVLETEYLGH ALPDGPAPKP ATGPGDHVGV HLQKDGRYYV       360
     GAAPVVGRVG GPVLSGLADL IDEVGAGRVR LTAHQKLVIL DVPEAGVERL VEGLEGLGLT       420
     ARPSPFRRTT MACTGIEFCK LAIVETKDTA AAAITELERR LADVVADGSL DEPIQLNVNG       480
     CPNSCARIQT ADIGLKGQIV TVDGPDGPVQ QAGFQVHLGG GLSTVERDEA GLGRTVRGLK       540
     VTAAELPDYV ERVIRSFIAR RSEGETFAAW ALRAEDGELL                             580
//

If you have problems or comments...

PBIL Back to PBIL home page