(data stored in ACNUC7421 zone)

EMBL: CP002343.PE84

CP002343.PE84        Location/Qualifiers
FT   CDS             94318..95556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0084"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="COGs: COG0007 Uroporphyrinogen-III methylase;
FT                   InterPro IPR000878: IPR006367: IPR006366; KEGG:
FT                   aau:AAur_3076 uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; SPTR: Uroporphyrin-III
FT                   C-methyltransferase, C-terminal:Siroheme
FT                   synthase,N-terminal; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase; siroheme synthase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase; siroheme synthase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46646"
FT                   /db_xref="GOA:E6SEP5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP5"
FT                   /protein_id="ADU46646.1"
FT                   /translation="MKSALPLVVDLTGRLVVAVGGGPVSARRVRAFVDEGAVVRVVSPW
FT                   VCEDLRDLVLDGTVEWQARDYTGAGDLDGAWLVHTAVGEPEVDRRVAGDAERLRIWCVD
FT                   ATDASARSASVAARTDVATPDGRVTISTYAAGDPGLATSLRDGVAEAVTQGRLDLRRTR
FT                   ERVSADAKPSGWVALVGGGPGSDGLLTARGHELLRSADVVVVDRLAPRGLLERLPASVR
FT                   VVDVGKTPGHHAVPQWRINEILVEEASRGLGVVRLKGGDPYVLGRGGEERQACEAAGLA
FT                   VEVVPGVTSAVSVPAAAGIPVTHRGVARGFTVVTGHEAIPGLPTGGDHTLVLLMGVSLL
FT                   EQTVTALVAQGRSLDSPVAIVERGFSPTQRTTVGTLSSIAELAREREVGSPAVIVVGDV
FT                   VRLSPEWPGDPAG"
     MKSALPLVVD LTGRLVVAVG GGPVSARRVR AFVDEGAVVR VVSPWVCEDL RDLVLDGTVE        60
     WQARDYTGAG DLDGAWLVHT AVGEPEVDRR VAGDAERLRI WCVDATDASA RSASVAARTD       120
     VATPDGRVTI STYAAGDPGL ATSLRDGVAE AVTQGRLDLR RTRERVSADA KPSGWVALVG       180
     GGPGSDGLLT ARGHELLRSA DVVVVDRLAP RGLLERLPAS VRVVDVGKTP GHHAVPQWRI       240
     NEILVEEASR GLGVVRLKGG DPYVLGRGGE ERQACEAAGL AVEVVPGVTS AVSVPAAAGI       300
     PVTHRGVARG FTVVTGHEAI PGLPTGGDHT LVLLMGVSLL EQTVTALVAQ GRSLDSPVAI       360
     VERGFSPTQR TTVGTLSSIA ELAREREVGS PAVIVVGDVV RLSPEWPGDP AG               412
//

If you have problems or comments...

PBIL Back to PBIL home page