(data stored in SCRATCH zone)

EMBL: CP002343.PE88

CP002343.PE88        Location/Qualifiers
FT   CDS             complement(97861..98313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_6437 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46650"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP9"
FT                   /protein_id="ADU46650.1"
FT                   /translation="MGCLLRSRSYCVYAVTMSPKSPSPVALALAAVEDALRHVDPDRPS
FT                   AALPHLRAAQDHLTRAIDEAMATAVLAEGSTIRTAGSLAGLSENAVGPRLARTSLLSAY
FT                   AGPDSGRVTASGVERARYDLEEGRHRRTDPGADPSRPMRFRARRPT"
     MGCLLRSRSY CVYAVTMSPK SPSPVALALA AVEDALRHVD PDRPSAALPH LRAAQDHLTR        60
     AIDEAMATAV LAEGSTIRTA GSLAGLSENA VGPRLARTSL LSAYAGPDSG RVTASGVERA       120
     RYDLEEGRHR RTDPGADPSR PMRFRARRPT                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page