(data stored in ACNUC7421 zone)

EMBL: CP002343.PE9

CP002343.PE9         Location/Qualifiers
FT   CDS             10916..13030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0009"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR003594: IPR013506: IPR006171: IPR002288: IPR
FT                   011557: IPR001241: IPR018522: IPR000565; KEGG:
FT                   kse:Ksed_00060 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; PRIAM: DNA topoisomerase (ATP-hydrolyzing); SMART:
FT                   DNA topoisomerase II; ATP-binding region ATPase domain
FT                   protein; SPTR: DNA gyrase subunit B; TIGRFAM: DNA gyrase, B
FT                   subunit; PFAM: Toprim domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; DNA gyrase B; DNA gyrase B
FT                   subunit, carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46571"
FT                   /db_xref="GOA:E6SDW8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW8"
FT                   /protein_id="ADU46571.1"
FT                   /translation="MSDAAETTADSTNRPNVDHRPNGVDYDASAITVLEGLEAVRKRPG
FT                   MYIGSTGERGLHHLVYEIVDNSVDEALAGYADTIDITLLADGGVRVKDNGRGIPTDIHP
FT                   VEKMSAVELVLTQLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTTLKVAVRQKGYVHRM
FT                   SFTMGVPDGPLRREEATDETGTTITFWPNAEIFDSVDFDFETLRARLQQMAFLNKGLTL
FT                   NLVDERVDQRAEASEDVDLDGVESDLATVVEDGDNGHDVPTSGRKTLTAKTATYRYDGG
FT                   LVDYVNHLNSSKRSEPVHPEVIAIEVEDEARSLSLELAMQWTSAYSESVHTYANTINTH
FT                   EGGTHEEGFRAAMTKLINDFARKQNLLKEKDENLTGDDVREGLTAVISVKLGDPQFEGQ
FT                   TKTKLGNSEVKGFVQRAMTDEFGHWLETHPNEGKDIVRKSIQAAAARMAARKAREATRR
FT                   KGLLESGGLPGKLKDCQSKDPSLSEVFIVEGDSAGGSATQARNPHIQAILPIRGKILNV
FT                   EKARIDKILANQEVQALISAFGTGIGEDFDLAKARYHKIILMADADVDGMHIRTLLLTL
FT                   LFRFMRPLIEAGYVYLAQPPLFRLRWSNAPHQFAYSDRERDGLTELGKANGWRLPKDNP
FT                   VQRYKGLGEMNYQELGETTMDQSTRTLLQVTLDDAAKADEVFAVLMGEDVESRRTFIQK
FT                   NARDVRFLDI"
     MSDAAETTAD STNRPNVDHR PNGVDYDASA ITVLEGLEAV RKRPGMYIGS TGERGLHHLV        60
     YEIVDNSVDE ALAGYADTID ITLLADGGVR VKDNGRGIPT DIHPVEKMSA VELVLTQLHA       120
     GGKFGGGGYK VSGGLHGVGS SVVNALSTTL KVAVRQKGYV HRMSFTMGVP DGPLRREEAT       180
     DETGTTITFW PNAEIFDSVD FDFETLRARL QQMAFLNKGL TLNLVDERVD QRAEASEDVD       240
     LDGVESDLAT VVEDGDNGHD VPTSGRKTLT AKTATYRYDG GLVDYVNHLN SSKRSEPVHP       300
     EVIAIEVEDE ARSLSLELAM QWTSAYSESV HTYANTINTH EGGTHEEGFR AAMTKLINDF       360
     ARKQNLLKEK DENLTGDDVR EGLTAVISVK LGDPQFEGQT KTKLGNSEVK GFVQRAMTDE       420
     FGHWLETHPN EGKDIVRKSI QAAAARMAAR KAREATRRKG LLESGGLPGK LKDCQSKDPS       480
     LSEVFIVEGD SAGGSATQAR NPHIQAILPI RGKILNVEKA RIDKILANQE VQALISAFGT       540
     GIGEDFDLAK ARYHKIILMA DADVDGMHIR TLLLTLLFRF MRPLIEAGYV YLAQPPLFRL       600
     RWSNAPHQFA YSDRERDGLT ELGKANGWRL PKDNPVQRYK GLGEMNYQEL GETTMDQSTR       660
     TLLQVTLDDA AKADEVFAVL MGEDVESRRT FIQKNARDVR FLDI                        704
//

If you have problems or comments...

PBIL Back to PBIL home page