(data stored in ACNUC7421 zone)

EMBL: CP002343.PE90

CP002343.PE90        Location/Qualifiers
FT   CDS             complement(99164..99814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0090"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR007627: IPR013249: IPR014284; KEGG: nca:Noca_4535 RNA
FT                   polymerase sigma factor SigK; PFAM: sigma-70 region 2
FT                   domain protein; Sigma-70 region 4 type 2; SPTR: RNA
FT                   polymerase sigma factor; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70
FT                   region 2; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46652"
FT                   /db_xref="GOA:E6SEQ1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEQ1"
FT                   /protein_id="ADU46652.1"
FT                   /translation="MARFSVVPSGDASSPGAATGPVAPVEPVEPVEPFEPIELGDLLGR
FT                   AATGDEGAFGEFYDRTSARVHGLVRRVVRDPAQSEEVTQEVFLELWRQSARYDSGKGSV
FT                   LAWVMTIAHRKAVDRVRSSESARGRDAAYGAATVDVAHDHTSEVAVQRLEGERVRRALG
FT                   SLTEAQRRAVELAYLSGYTHTEVAGLLDLPLGTAKTRIRDGLIRLRDTLGVTS"
     MARFSVVPSG DASSPGAATG PVAPVEPVEP VEPFEPIELG DLLGRAATGD EGAFGEFYDR        60
     TSARVHGLVR RVVRDPAQSE EVTQEVFLEL WRQSARYDSG KGSVLAWVMT IAHRKAVDRV       120
     RSSESARGRD AAYGAATVDV AHDHTSEVAV QRLEGERVRR ALGSLTEAQR RAVELAYLSG       180
     YTHTEVAGLL DLPLGTAKTR IRDGLIRLRD TLGVTS                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page